Property Summary

NCBI Gene PubMed Count 118
Grant Count 104
R01 Count 51
Funding $13,070,329.52
PubMed Score 417.33
PubTator Score 203.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55058 A8K006 B4DDD5 B4DRB4 E1P5N8 E7EV16 Q8WTT1 Q9BR07 Q9BSH8
Symbols BPIFE
HDLCQ9

Gene

Gene RIF (90)

PMID Text
26337529 The domain of apolipoprotein E4 required for PLTP activation resides within its amino-terminal 1-185 region.
26009633 a novel association between PLTPa and PON1 activity
25710294 Elevated baseline plasma levels of PLTP are associated with an increased risk of long-term all-cause mortality in patients with diabetes and known or suspected coronary disease.
25651711 High systemic PLTP expression does not contribute significantly to a renal phenotype despite being implicated in systemic atherosclerosis in ApoE deficient mice.
25304745 Elevated plasma PLTP activity may predict an increased risk of T2DM in men
25107452 This review summarizes the recent progresses made in the PLTP research field and focuses on the complexity of the implication of PLTP in obesity, insulin resistance and type 2 diabetes mellitus. [review]
24532668 proteolytic cleavage of PLTP by cathepsin G may enhance the injurious inflammatory responses that occur in COPD
24369175 PLTP is actively involved in lipid transfer, cholesterol efflux, HDL genesis, and remodeling at the blood-brain barrier.
23545183 Higher PLTP activity is associated with depressed LV systolic function in a dose-dependent manner.
23477743 Lower plasma CETP or higher PLTP activity was each associated with a significantly increased risk of cardiovascular disease.
More...

AA Sequence

MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV      1 - 70
TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMK     71 - 140
VSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVD    141 - 210
ELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESY    211 - 280
FRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASV    281 - 350
TIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI    351 - 420
GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADVRASTAPTPST    421 - 490
AAV                                                                       491 - 493
//

Text Mined References (121)

PMID Year Title
26337529 2015 Influence of Isoforms and Carboxyl-Terminal Truncations on the Capacity of Apolipoprotein E To Associate with and Activate Phospholipid Transfer Protein.
26009633 2015 PLTP activity inversely correlates with CAAD: effects of PON1 enzyme activity and genetic variants on PLTP activity.
25710294 2015 Elevated baseline plasma phospholipid protein (PLTP) levels are an independent predictor of long-term all-cause mortality in patients with diabetes mellitus and known or suspected coronary artery disease.
25651711 2014 No renal phenotype in human phospholipid transfer protein transgenic apolipoprotein E deficient mice despite severe aortic atherosclerosis.
25304745 2015 Phospholipid transfer protein activity and incident type 2 diabetes mellitus.
25107452 2014 Phospholipid transfer protein in diabetes, metabolic syndrome and obesity.
24532668 2014 Cathepsin G degradation of phospholipid transfer protein (PLTP) augments pulmonary inflammation.
24369175 2014 Phospholipid transfer protein is expressed in cerebrovascular endothelial cells and involved in high density lipoprotein biogenesis and remodeling at the blood-brain barrier.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23545183 2013 High PLTP activity is associated with depressed left ventricular systolic function.
More...