Property Summary

NCBI Gene PubMed Count 34
PubMed Score 7.03
PubTator Score 9.82

Knowledge Summary

Patent

No data available

Synonym

Accession P55056 B3KWY6 Q53YY8 Apo-CIV
Symbols APO-CIV
APOC-IV

Gene

Gene RIF (19)

PMID Text
26129832 APOC4 rs1132899 polymorphism was associated with an increased risk of premature coronary artery disease in Chinese subjects.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
20972250 Observational study of gene-disease association. (HuGE Navigator)
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20498921 This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort.
More...

AA Sequence

MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQ      1 - 70
WFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG                  71 - 127
//

Text Mined References (36)

PMID Year Title
26129832 2015 The association of APOC4 polymorphisms with premature coronary artery disease in a Chinese Han population.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
More...