Property Summary

NCBI Gene PubMed Count 119
Grant Count 20
R01 Count 12
Funding $1,317,171.02
PubMed Score 40.62
PubTator Score 125.47

Knowledge Summary

Patent (7,498)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 0.000
diabetes mellitus -1.500 0.001

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
2117 screening 7 / 0 / 0 Late stage results from the probe development effort to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR).
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463143 screening 0 / 0 / 6 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based cell-based assay to identify activators of the liver X receptor (LXR)
463150 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify activators of the liver X receptor (LXR)
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16
720737 confirmatory 0 / 0 / 240 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR).
743027 screening 1 / 0 / 3415 Counterscreen for agonists of the DAF-12 from the parasite H.contortus (hcDAF-12): Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR).
743037 confirmatory 0 / 0 / 247 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based dose response assay to identify agonists of the Liver-X-Receptor (LXR).
743051 screening 0 / 0 / 3347 Counterscreen for agonists of the daf-12 abnormal Dauer Formation: Luminescence-based cell-based screening assay to identify agonists of the Liver-X-Receptor (LXR)
More...

Gene RIF (98)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
26602218 Intestinal activation of LXR reduces the production of chylomicrons by a mechanism dependent on the apical localization of SR-B1.
26450852 predominant cytoplasmic localization of LXRbeta, which occurs in colon cancer cells but not in normal colon epithelial cells, allowed LXR ligand-induced pyroptosis
26434697 Destabilization of the torsioned conformation of a ligand side chain inverts the LXRbeta activity.
26263968 the release of NER components such as DNA damage binding protein 2 (DDB2) and Xeroderma Pigmentosum complementation group C protein (XPC) following oxidative stress might putatively involve their apoptotic role rather than DNA repair function.
26019035 LXRalpha expression was not altered in NAFLD.
26009170 Recent high-throughput analyses of RNA-protein interactions indicate that Unr binds to a large subset of cellular mRNAs, suggesting that Unr may play a wider role in translational responses to cellular signals than previously thought.
25980575 This study provides the first evidence to show LXR activation reduces cadmium-induced apoptotic cell death of human renal proximal tubular cells by inhibition of reactive oxygen species production and JNK activation.
25659329 LXRb is the dominant isoform in the rat myocardium and the expression of both LXR isoforms (LXRa and LXRb) did not change after administration of T0901317
25124554 LXR-b, through pannexin 1 interaction, can specifically induce caspase-1-dependent colon cancer cell death by pyroptosis.
More...

AA Sequence

MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE      1 - 70
RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK     71 - 140
CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQG    141 - 210
SGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQE    211 - 280
IVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFIN    281 - 350
PIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM    351 - 420
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE                                  421 - 460
//

Text Mined References (120)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
26602218 2016 Liver X Receptor Regulates Triglyceride Absorption Through Intestinal Down-regulation of Scavenger Receptor Class B, Type 1.
26450852 2015 Liver X receptor ligand cytotoxicity in colon cancer cells and not in normal colon epithelial cells depends on LXR? subcellular localization.
26434697 2015 Destabilization of the torsioned conformation of a ligand side chain inverts the LXR? activity.
26263968 2015 Combination of A? Secretion and Oxidative Stress in an Alzheimer-Like Cell Line Leads to the Over-Expression of the Nucleotide Excision Repair Proteins DDB2 and XPC.
26120082 2015 Broad Anti-tumor Activity of a Small Molecule that Selectively Targets the Warburg Effect and Lipogenesis.
26019035 The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
26009170 2015 Post-transcriptional regulation of gene expression by Unr.
25980575 2015 Activation of liver X receptors inhibits cadmium-induced apoptosis of human renal proximal tubular cells.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
More...