Property Summary

Ligand Count 287
NCBI Gene PubMed Count 132
PubMed Score 49.77
PubTator Score 125.47

Knowledge Summary

Patent (7,498)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Cholestasis 155 0.0 0.0
Hepatomegaly 285 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count P-value
psoriasis 6694 2.2e-04
diabetes mellitus 1728 1.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.500 1.4e-03
psoriasis 1.400 2.2e-04

Protein-protein Interaction (1)

Gene RIF (110)

AA Sequence

MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE      1 - 70
RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK     71 - 140
CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQG    141 - 210
SGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQE    211 - 280
IVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFIN    281 - 350
PIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM    351 - 420
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE                                  421 - 460
//

Text Mined References (133)

PMID Year Title