Property Summary

NCBI Gene PubMed Count 36
PubMed Score 334.37
PubTator Score 348.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 2.583 1.8e-07
cystic fibrosis 1.507 1.1e-04
dermatomyositis 1.800 1.2e-02
diabetes mellitus -2.000 3.3e-02
ependymoma 1.400 1.9e-03
esophageal adenocarcinoma -1.700 2.0e-02
hereditary spastic paraplegia 1.289 6.7e-03
invasive ductal carcinoma -1.100 1.2e-02
lung adenocarcinoma -1.165 5.1e-03
lung carcinoma -1.100 7.1e-06
malignant mesothelioma 1.800 1.3e-05
nasopharyngeal carcinoma -2.800 2.0e-07
non-small cell lung cancer -2.586 7.9e-14
ovarian cancer 1.300 1.5e-03
tuberculosis -1.100 3.8e-02
Waldenstrons macroglobulinemia -1.121 2.3e-02

Gene RIF (19)

AA Sequence

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL      1 - 70
DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL     71 - 140
MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS    141 - 210
REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR    211 - 280
FLGRIVARNSRKMAFRAKSKSCHDLSVL                                              281 - 308
//

Text Mined References (36)

PMID Year Title