Property Summary

NCBI Gene PubMed Count 36
Grant Count 133
R01 Count 22
Funding $144,788,157.32
PubMed Score 323.14
PubTator Score 348.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.121 0.023
malignant mesothelioma 1.800 0.000
esophageal adenocarcinoma -1.700 0.020
ependymoma 1.400 0.002
cystic fibrosis 1.507 0.000
hereditary spastic paraplegia 1.289 0.007
acute quadriplegic myopathy 2.980 0.000
tuberculosis -1.100 0.038
non-small cell lung cancer -2.586 0.000
diabetes mellitus -2.000 0.033
nasopharyngeal carcinoma -2.900 0.000
lung adenocarcinoma -1.165 0.005
lung carcinoma -1.100 0.000
invasive ductal carcinoma -1.100 0.012
ovarian cancer 1.300 0.002
dermatomyositis 1.900 0.012

Synonym

Accession P55042 Q96F39
Symbols RAD
RAD1
REM3

Gene

PDB

2DPX   2GJS   3Q72   3Q7P   3Q7Q  

Gene RIF (18)

PMID Text
26344687 Brg1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating RRAD in aortic dissection.
25893381 Data show that Ras-related associated with diabetes protein (RRAD) directly binds to the p65 subunit of the NF-kappa B (NF-kappaB)complex and inhibits the nuclear translocation of p65, which in turn negatively regulates the NF-kappaB signaling
25313011 RRAD promotes EGFR-mediated STAT3 activation and induces temozolomide resistance of malignant glioblastoma.
25114038 RRAD expression is frequently decreased in lung cancer. Ectopic expression of RRAD greatly reduces glycolysis whereas knockdown of RRAD promotes glycolysis in lung cancer cells.
24648519 Ras(V12)-mediated oncogenic transformation induces RRAD epigenetic inactivation, which in turn promotes glucose uptake and may contribute to ovarian cancer
24632303 Rad suppresses the NF-Kappa-B mediated transcription and downstream gene activation. Rad can directly bind to RelA/p65 and suppress the interaction of RelA/p65 with the NF-kappa-B response DNA element.
24222170 RRAD hypermethylation is associated with esophageal squamous cell carcinoma.
23973784 Mouse Rad Q65P (the murine equivalent of human Rad Q66P) inhibits L-type currents conducted by CaV1.2 or CaV1.3 channels as potently as wild-type Rad (>95% inhibition of both channels).
22658652 Rad over expression could be a molecular target to improve bortezomib sensitivity in human leukemia and lymphoma.
22487779 results indicate that RRAD might act as a functional tumor suppressor and its epigenetic inactivation may play an important role in NPC development
More...

AA Sequence

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL      1 - 70
DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL     71 - 140
MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS    141 - 210
REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR    211 - 280
FLGRIVARNSRKMAFRAKSKSCHDLSVL                                              281 - 308
//

Text Mined References (36)

PMID Year Title
26546438 2016 RRAD inhibits aerobic glycolysis, invasion, and migration and is associated with poor prognosis in hepatocellular carcinoma.
26344687 2015 Brahma-related gene 1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating Ras-related associated with diabetes in the pathophysiologic processes of aortic dissection.
25893381 2015 RRAD inhibits the Warburg effect through negative regulation of the NF-?B signaling.
25313011 2014 RRAD promotes EGFR-mediated STAT3 activation and induces temozolomide resistance of malignant glioblastoma.
25114038 2014 Tumor suppressor p53 negatively regulates glycolysis stimulated by hypoxia through its target RRAD.
24992013 2014 Ancient origins of RGK protein function: modulation of voltage-gated calcium channels preceded the protostome and deuterostome split.
24648519 2014 Ras-induced epigenetic inactivation of the RRAD (Ras-related associated with diabetes) gene promotes glucose uptake in a human ovarian cancer model.
24632303 2014 Rad GTPase inhibits the NF?B pathway through interacting with RelA/p65 to impede its DNA binding and target gene transactivation.
24222170 2013 Aberrant methylation of the Ras-related associated with diabetes gene in human primary esophageal cancer.
23973784 2013 Potent inhibition of L-type Ca2+ currents by a Rad variant associated with congestive heart failure.
More...