Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.07
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -2.132 2.0e-04
atypical teratoid / rhabdoid tumor 1.900 2.3e-02
Breast cancer -1.800 5.0e-08
breast carcinoma -1.100 1.6e-10
colon cancer -2.900 3.0e-03
ependymoma 2.600 2.8e-11
gastric carcinoma 1.900 1.1e-02
glioblastoma 2.400 5.0e-03
interstitial cystitis 1.800 1.2e-03
intraductal papillary-mucinous adenoma (... -1.500 3.9e-02
intraductal papillary-mucinous neoplasm ... -2.100 2.0e-02
lung cancer -1.900 1.4e-05
lung carcinoma -1.100 1.5e-04
malignant mesothelioma -2.300 7.0e-08
ovarian cancer 1.700 7.9e-03
pancreatic cancer 3.900 5.2e-05
pediatric high grade glioma 1.300 1.6e-02
pituitary cancer -2.700 3.7e-05
primary pancreatic ductal adenocarcinoma 4.027 3.0e-06
spina bifida -1.695 3.6e-02
subependymal giant cell astrocytoma 2.769 2.2e-02
tuberculosis -4.900 3.7e-10
ulcerative colitis 2.700 7.5e-06

Gene RIF (10)

AA Sequence

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE      1 - 70
SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE     71 - 140
WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA    141 - 210
VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN    211 - 280
MAFKLKSKSCHDLSVL                                                          281 - 296
//

Text Mined References (26)

PMID Year Title