Property Summary

NCBI Gene PubMed Count 22
Grant Count 75
R01 Count 46
Funding $6,968,154.06
PubMed Score 4.68
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P55040 B2RA31
Symbols KIR

Gene

GEM

PDB

2CJW   2G3Y   2HT6  

Gene RIF (9)

PMID Text
25173885 These findings demonstrate a new role of Gem/Gmip/RhoA signaling in cortical actin regulation during early mitotic stages.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of GTP binding protein overexpressed in skeletal muscle (GEM) in primary human brain microvascular endothelial cells
24586148 Gem is involved both in T-cell spontaneous cell migration as well as chemotaxis and plays an important role in cell-to-cell HTLV-1 viral transmission.
22964304 Data show a mechanism by which GTPase Gem contributes to the mitotic progression by maintaining correct spindle length through the kinesin Kif9.
22589533 Gem contains two candidate inhibitory sites, each capable of producing full inhibition of P/Q-type Ca(2+) channels.
20233927 GEM plays a key role during C. pneumoniae entry into human cells.
17107948 Gem is a bona fide GTPase that exhibits striking structural and biochemical features that should impact its regulation and cellular activities
17052716 crystallographic structure and biochemical characterization indicate that Gem G-domain markedly prefers GDP over GTP
16242932 We discuss the structural and functional properties of RGK proteins and highlight recent work addressing the mechanism of Gem regulation by calmodulin and 14-3-3.

AA Sequence

MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE      1 - 70
SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE     71 - 140
WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA    141 - 210
VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN    211 - 280
MAFKLKSKSCHDLSVL                                                          281 - 296
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25173885 2014 Gem GTPase acts upstream Gmip/RhoA to regulate cortical actin remodeling and spindle positioning during early mitosis.
24586148 2014 Gem-induced cytoskeleton remodeling increases cellular migration of HTLV-1-infected cells, formation of infected-to-target T-cell conjugates and viral transmission.
22964304 2012 The GTPase Gem and its partner Kif9 are required for chromosome alignment, spindle length control, and mitotic progression.
22589533 2012 Molecular determinants of Gem protein inhibition of P/Q-type Ca2+ channels.
20233927 2010 A systemic network for Chlamydia pneumoniae entry into human cells.
19060904 2009 An empirical framework for binary interactome mapping.
17107948 2007 Biochemical and structural characterization of the gem GTPase.
17052716 2006 Structure-function studies of the G-domain from human gem, a novel small G-protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...