Property Summary

NCBI Gene PubMed Count 95
Grant Count 49
R01 Count 40
Funding $13,530,062.27
PubMed Score 133.81
PubTator Score 90.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.196 0.003
lung cancer 1.300 0.000
ovarian cancer 2.000 0.000

Gene RIF (57)

PMID Text
26903513 regulation of NY-ESO-1 processing by the ubiquitin receptors Rpn10 and Rpn13 as a well as by the standard and immunoproteasome is governed by non-canonical ubiquitination on non-lysine sites.
25897558 Not only AF1, but an entire proteasome complex, seems to be present in blood.
25318673 The VWA domain regulation of ubiquitin and Ubl binding to S5a is restricted to the 26S proteasome.
24829148 binds to death receptor-6, and induces monocyte cell line differentiation via NF-kB pathway
24250289 To examine angiocidin expression in SMMC-7221 and HepG2 cells and the role of angiocidin in liver cancer cell growth. Angiocidin is highly expressed in liver cancer cells, and it may play a key role in tumor growth of liver cancers.
24121268 The degradation of TP53 and MDM2 by the proteasome can be selectively dependent on S5a in human cells.
24074603 One consequence of the interaction between E6/E6AP and S5a is enhanced ubiquitination of this proteasome subunit.
23966401 Authors demonstrate that human cytomegalovirus UL76 induces a novel nuclear aggresome, likely by subverting S5a of the ubiquitin-proteasome system.
23515276 These studies suggest that diminished 26S activity in failing human hearts may be related ti impaired docking of the 19S to the 20S as a result of decreased Rpt subunit ATPase activity and alpha7 subunit phosphorylation.
22434192 identified the VWA domain of hRpn10 as a receptor for ubiquitin-like proteins within the 26S proteasome and elucidated how FAT10 mediates efficient proteolysis by the proteasome
More...

AA Sequence

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR      1 - 70
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI     71 - 140
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP    141 - 210
SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS    211 - 280
MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE    281 - 350
AIRNAMGSLASQATKDGKKDKKEEDKK                                               351 - 377
//

Text Mined References (105)

PMID Year Title
26903513 2016 Major Histocompatibility Complex (MHC) Class I Processing of the NY-ESO-1 Antigen Is Regulated by Rpn10 and Rpn13 Proteins and Immunoproteasomes following Non-lysine Ubiquitination.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25897558 2016 Interaction of Proteasomes and Complement C3, Assay of Antisecretory Factor in Blood.
25318673 2014 VWA domain of S5a restricts the ability to bind ubiquitin and Ubl to the 26S proteasome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24829148 2014 S5a binds to death receptor-6 to induce THP-1 monocytes to differentiate through the activation of the NF-?B pathway.
24811749 2014 Autoubiquitination of the 26S proteasome on Rpn13 regulates breakdown of ubiquitin conjugates.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24250289 2013 Reduction of angiocidin contributes to decreased HepG2 cell proliferation.
24121268 2014 The degradation of p53 and its major E3 ligase Mdm2 is differentially dependent on the proteasomal ubiquitin receptor S5a.
More...