Property Summary

Ligand Count 13
NCBI Gene PubMed Count 116
PubMed Score 634.19
PubTator Score 285.46

Knowledge Summary


No data available


  Disease (7)

Disease Target Count P-value
psoriasis 6694 6.4e-23
ovarian cancer 8519 1.5e-08
osteosarcoma 7950 3.3e-05
malignant mesothelioma 3232 1.8e-03
cutaneous lupus erythematosus 1057 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0


  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.6e-03
malignant mesothelioma 1.100 1.8e-03
osteosarcoma -1.034 3.3e-05
ovarian cancer 1.200 1.5e-08
psoriasis 1.900 6.4e-23

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (106)

AA Sequence

RKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYCQ                                 981 - 1021

Text Mined References (130)

PMID Year Title