Property Summary

NCBI Gene PubMed Count 66
Grant Count 310
R01 Count 180
Funding $53,721,637.18
PubMed Score 860.28
PubTator Score 279.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55011 Q8N713 Q8WWH7
Symbols BSC
BSC2
NKCC1
PPP1R141

Gene

 GWAS Trait (1)

Gene RIF (48)

PMID Text
25620102 The NKCC-1 is a Na(+)- dependent Cl(-) transporter that mediates the movement of Na(+), K(+), and Cl(-) ions across the plasma membrane and maintains cell volume and intracellular K(+) and Cl(-) homeostasis.
25218052 NKCC1 labeling was seen only in the basolateral membrane of the secretory coils.
24944475 Suggest that the expression of NKCC1 in esophageal squamous cell carcinoma may affect the G2/M checkpoint and may be related to the degree of histological differentiation of SCCs.
24555568 our data show a novel role for the WNK1/OSR1/NKCC1 pathway in glioma migration
24451383 NKCC activation involves movement of TM12 relative to TM10, which is likely tied to movement of the large C terminus
24339991 Functional expression of human NKCC1 from a synthetic cassette-based cDNA: introduction of extracellular epitope tags and removal of cysteines.
24173102 The hormone aldosterone was found to upregulate NKCC1 by increasing protein stability.
23921125 Altered hippocampal area function and coupling in DISC1 and SLC12A2 minor allele carriers.
23894354 Reduced KCC2/NKCC1 ratio in the cerebrospinal fluid of Rett Syndrome patients suggests a disturbed process of GABAergic neuronal maturation and open up a new therapeutic perspective.
23515529 The results indicate a role for COMMD1 in the regulation of NKCC1 membrane expression and ubiquitination.
More...

AA Sequence

MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEGPAAAGDGLGR      1 - 70
PLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADGEASGESEPAKGSEEAKGRFR     71 - 140
VNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYL    141 - 210
RTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK    211 - 280
GVVKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGG    281 - 350
GAYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL    351 - 420
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFREEETFFSV    421 - 490
FAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSVGSCVVRDATGNVNDTIVTEL    491 - 560
TNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALC    561 - 630
KDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAK    631 - 700
SPGWRPAFKYYNMWISLLGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNA    701 - 770
LQHSIRLSGVEDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA    771 - 840
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDA    841 - 910
FDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEE    911 - 980
DGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDDGGLTLLIPYLLTTKKKWK    981 - 1050
DCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQ   1051 - 1120
DIADKMKEDEPWRITDNELELYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEAL   1121 - 1190
SKDLPPILLVRGNHQSVLTFYS                                                   1191 - 1212
//

Text Mined References (70)

PMID Year Title
25620102 2015 Ion transporters in brain tumors.
25218052 2014 Localization of Na(+)-K(+)-ATPase ?/?, Na(+)-K(+)-2Cl-cotransporter 1 and aquaporin-5 in human eccrine sweat glands.
24944475 2014 Role of the Na ?/K ?/2Cl? cotransporter NKCC1 in cell cycle progression in human esophageal squamous cell carcinoma.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24555568 2014 WNK1-OSR1 kinase-mediated phospho-activation of Na+-K+-2Cl- cotransporter facilitates glioma migration.
24451383 2014 Molecular motions involved in Na-K-Cl cotransporter-mediated ion transport and transporter activation revealed by internal cross-linking between transmembrane domains 10 and 11/12.
24339991 2013 Functional expression of human NKCC1 from a synthetic cassette-based cDNA: introduction of extracellular epitope tags and removal of cysteines.
24173102 2014 Direct control of Na(+)-K(+)-2Cl(-)-cotransport protein (NKCC1) expression with aldosterone.
23921125 2013 DISC1 and SLC12A2 interaction affects human hippocampal function and connectivity.
23894354 2013 Abnormal expression of cerebrospinal fluid cation chloride cotransporters in patients with Rett syndrome.
More...