Property Summary

NCBI Gene PubMed Count 66
PubMed Score 860.28
PubTator Score 279.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Edema 38
Hypertensive disorder 58
Disease Target Count P-value
psoriasis 6685 1.38742657359287E-7
malignant mesothelioma 3163 1.72924545853838E-7
lung cancer 4473 6.28714940708554E-6
tuberculosis 1563 6.45130945223031E-6
ependymoma 2514 9.18816795099994E-5
atypical teratoid / rhabdoid tumor 4369 1.19196739174171E-4
medulloblastoma, large-cell 6234 1.55720443216831E-4
glioblastoma 5572 9.14567781124993E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00182459879095809
pancreatic cancer 2300 0.00186605693379552
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00208485194130187
active ulcerative colitis 477 0.00235214817075587
primary pancreatic ductal adenocarcinoma 1271 0.00310443137220459
ovarian cancer 8492 0.00344834678438973
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0113761502578666
invasive ductal carcinoma 2950 0.0171898217914624
chronic rhinosinusitis 512 0.0244409708185044
Breast cancer 3099 0.0286379544615374
cutaneous lupus erythematosus 1056 0.0289414447293407
ductal carcinoma in situ 1745 0.0339162156068037
group 4 medulloblastoma 1875 0.0415977675972978
progressive supranuclear palsy 674 0.0436341355816435
colon cancer 1475 0.0441589791502876
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Small intestine cancer 3 0.0 1.0

Expression

Synonym

Accession P55011 Q8N713 Q8WWH7
Symbols BSC
BSC2
NKCC1
PPP1R141

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (48)

PMID Text
25620102 The NKCC-1 is a Na(+)- dependent Cl(-) transporter that mediates the movement of Na(+), K(+), and Cl(-) ions across the plasma membrane and maintains cell volume and intracellular K(+) and Cl(-) homeostasis.
25218052 NKCC1 labeling was seen only in the basolateral membrane of the secretory coils.
24944475 Suggest that the expression of NKCC1 in esophageal squamous cell carcinoma may affect the G2/M checkpoint and may be related to the degree of histological differentiation of SCCs.
24555568 our data show a novel role for the WNK1/OSR1/NKCC1 pathway in glioma migration
24451383 NKCC activation involves movement of TM12 relative to TM10, which is likely tied to movement of the large C terminus
24339991 Functional expression of human NKCC1 from a synthetic cassette-based cDNA: introduction of extracellular epitope tags and removal of cysteines.
24173102 The hormone aldosterone was found to upregulate NKCC1 by increasing protein stability.
23921125 Altered hippocampal area function and coupling in DISC1 and SLC12A2 minor allele carriers.
23894354 Reduced KCC2/NKCC1 ratio in the cerebrospinal fluid of Rett Syndrome patients suggests a disturbed process of GABAergic neuronal maturation and open up a new therapeutic perspective.
23515529 The results indicate a role for COMMD1 in the regulation of NKCC1 membrane expression and ubiquitination.
More...

AA Sequence

MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEGPAAAGDGLGR      1 - 70
PLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADGEASGESEPAKGSEEAKGRFR     71 - 140
VNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYL    141 - 210
RTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK    211 - 280
GVVKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGG    281 - 350
GAYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL    351 - 420
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFREEETFFSV    421 - 490
FAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSVGSCVVRDATGNVNDTIVTEL    491 - 560
TNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALC    561 - 630
KDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAK    631 - 700
SPGWRPAFKYYNMWISLLGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNA    701 - 770
LQHSIRLSGVEDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA    771 - 840
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDA    841 - 910
FDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEE    911 - 980
DGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDDGGLTLLIPYLLTTKKKWK    981 - 1050
DCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQ   1051 - 1120
DIADKMKEDEPWRITDNELELYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEAL   1121 - 1190
SKDLPPILLVRGNHQSVLTFYS                                                   1191 - 1212
//

Text Mined References (70)

PMID Year Title
25620102 2015 Ion transporters in brain tumors.
25218052 2014 Localization of Na(+)-K(+)-ATPase ?/?, Na(+)-K(+)-2Cl-cotransporter 1 and aquaporin-5 in human eccrine sweat glands.
24944475 2014 Role of the Na ?/K ?/2Cl? cotransporter NKCC1 in cell cycle progression in human esophageal squamous cell carcinoma.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24555568 2014 WNK1-OSR1 kinase-mediated phospho-activation of Na+-K+-2Cl- cotransporter facilitates glioma migration.
24451383 2014 Molecular motions involved in Na-K-Cl cotransporter-mediated ion transport and transporter activation revealed by internal cross-linking between transmembrane domains 10 and 11/12.
24339991 2013 Functional expression of human NKCC1 from a synthetic cassette-based cDNA: introduction of extracellular epitope tags and removal of cysteines.
24173102 2014 Direct control of Na(+)-K(+)-2Cl(-)-cotransport protein (NKCC1) expression with aldosterone.
23921125 2013 DISC1 and SLC12A2 interaction affects human hippocampal function and connectivity.
23894354 2013 Abnormal expression of cerebrospinal fluid cation chloride cotransporters in patients with Rett syndrome.
More...