Property Summary

NCBI Gene PubMed Count 31
Grant Count 38
R01 Count 34
Funding $3,383,905.29
PubMed Score 79.32
PubTator Score 33.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis 1.700 0.001
osteosarcoma -2.437 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.300 0.000
hereditary spastic paraplegia -1.217 0.008
tuberculosis and treatment for 6 months 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.941 0.001
non-small cell lung cancer -1.309 0.000
lung cancer -3.400 0.000
colon cancer -1.200 0.030
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
lung adenocarcinoma -1.300 0.000
Pick disease -1.200 0.000
Breast cancer -1.900 0.000
ovarian cancer 2.100 0.000
dermatomyositis 1.300 0.002

Gene RIF (9)

PMID Text
26717981 it is eIF5-induced GTP hydrolysis and Pi release that irreversibly trap the 48S complex, and this complex is further stabilized by eIF5B and 60S joining.
25631074 Cellular biotinylated eukaryotic translation initiation factor 5 (EIF5) protein is incorporated into HIV-1 Gag virus-like particles
24319994 The N-terminal tail of eIF1A mediates the interaction with eIF5 and eIF1.
23293029 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex
22813744 This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta.
22062548 miR-5787 represses cell growth, in part, by targeting eIF5.
16781736 The carboxy-terminal domain (CTD)of eIF5 is exclusively composed out of alpha-helices and is homologous to the carboxy-terminal domain of eIF2B-epsilon (eIF2Bepsilon-CTD). The binding sites of eIF2-beta, eIF3 and eIF1 were mapped onto the structure.
16584190 3-dimensional solution structure of N-terminal domain of human eIF5, has 2 subdomains, both reminiscent of nucleic-acid-binding modules. N-terminal subdomain contains "arginine finger" motif essential for GAP function.
16227438 CK2 may be involved in the regulation of cell cycle progression by associating with and phosphorylating a key molecule for translation initiation.

AA Sequence

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK      1 - 70
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF     71 - 140
ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE    141 - 210
AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL    211 - 280
TEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV    281 - 350
IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD    351 - 420
NKDDDIDIDAI                                                               421 - 431
//

Text Mined References (42)

PMID Year Title
26717981 2016 Sliding of a 43S ribosomal complex from the recognized AUG codon triggered by a delay in eIF2-bound GTP hydrolysis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
24319994 2013 The interaction between eukaryotic initiation factor 1A and eIF5 retains eIF1 within scanning preinitiation complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23293029 2013 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22813744 2012 The C-terminal domain of eukaryotic initiation factor 5 promotes start codon recognition by its dynamic interplay with eIF1 and eIF2?.
More...