Property Summary

NCBI Gene PubMed Count 34
PubMed Score 83.18
PubTator Score 33.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.100 4.7e-03
atypical teratoid / rhabdoid tumor -1.300 7.6e-05
Breast cancer -1.900 2.5e-29
colon cancer -1.200 3.0e-02
dermatomyositis 1.300 2.4e-03
glioblastoma -1.100 2.2e-06
hereditary spastic paraplegia -1.217 8.2e-03
lung adenocarcinoma -1.300 3.4e-10
lung cancer -1.500 3.7e-03
medulloblastoma, large-cell -1.300 1.3e-04
non-small cell lung cancer -1.309 1.2e-17
osteosarcoma -1.519 5.6e-06
ovarian cancer -1.200 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.941 1.2e-03
Pick disease -1.200 1.3e-05
Pilocytic astrocytoma -1.100 4.4e-07
psoriasis 1.300 5.6e-07
tuberculosis and treatment for 6 months 1.100 5.9e-05

Gene RIF (12)

AA Sequence

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK      1 - 70
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF     71 - 140
ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE    141 - 210
AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL    211 - 280
TEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV    281 - 350
IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD    351 - 420
NKDDDIDIDAI                                                               421 - 431
//

Text Mined References (46)

PMID Year Title