Property Summary

NCBI Gene PubMed Count 75
PubMed Score 1105.34
PubTator Score 231.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.793 4.0e-04
Astrocytoma, Pilocytic 1.400 1.0e-05
chronic lymphosyte leukemia -1.300 6.4e-09
cutaneous lupus erythematosus 1.500 6.9e-03
glioblastoma 2.100 1.4e-03
group 3 medulloblastoma -1.300 2.6e-02
head and neck cancer and chronic obstruc... 1.200 1.6e-03
interstitial cystitis 1.700 6.4e-04
intraductal papillary-mucinous adenoma (... -1.500 3.6e-04
intraductal papillary-mucinous carcinoma... -1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... -1.500 3.9e-03
invasive ductal carcinoma 1.100 4.1e-04
lung adenocarcinoma -1.094 4.2e-04
lung cancer -2.500 6.3e-06
lung carcinoma -1.800 4.0e-20
medulloblastoma, large-cell 1.200 1.1e-04
non-small cell lung cancer -1.359 5.1e-12
osteosarcoma -2.337 6.7e-04
ovarian cancer 1.100 1.6e-08
Pneumonia -1.100 2.3e-02
psoriasis -1.800 6.7e-04
subependymal giant cell astrocytoma 1.940 1.4e-02
tuberculosis 2.800 6.9e-10
ulcerative colitis 1.400 4.4e-05

Gene RIF (53)

AA Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSL      1 - 70
KRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAK     71 - 140
KAISELP                                                                   141 - 147
//

Text Mined References (79)

PMID Year Title