Property Summary

NCBI Gene PubMed Count 75
Grant Count 46
R01 Count 27
Funding $5,577,271.35
PubMed Score 562.88
PubTator Score 231.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
27442380 Using double labeling with Iba-1 and cd68 could determine the physiological state of microglia in brain contusion based on their morphology and immunoreactivity.
26585362 involved in the immunological process underlying rheumatoid arthritis
26324213 The results of our study suggest that the AIF1 gene polymorphisms have no influence on long-term kidney allograft function.
25998745 Data showed that AIF-1 promoted the proliferation of HepG2 cells by accelerating the activation of IGF-1R and its downstream signaling pathway, which confirms that AIF-1 plays a crucial role in the development of hepatocellular carcinoma cells.
25026748 The results of this study suggest a lack of association between AIF-1 gene polymorphisms and response to sulphasalazine treatment in rheumatoid arthritis.
24796669 AIF-1, which induced chemokines and enhanced chemotaxis of monocytes, may represent a molecular target for the therapy of immune-inflammatory disorders
24742347 HIV-1 and the viral protein Tat modulate the expression of allograft inflammatory factor 1 (AIF1) in immature dendritic cells and monocyte-derived macrophages
24337893 AIF-1 functions as a tumor suppressor possibly by regulating beta-catenin in gastric cancer. the level of AIF-1 expression may serve as a protective prognostic indicator for gastric cancer.
24018427 The results of this study suggest that the patients with the rs2259571 CC AIF1 genotype have a poorer response to therapy with Methotrexate.
23867161 The overexpressed AIF-1, the novel inflammatory polypeptide derived from macrophage lineages, is closely associated with atherogenesis via affecting the blood composition and promoting macrophage uptake and foam cell formation.
More...

AA Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSL      1 - 70
KRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAK     71 - 140
KAISELP                                                                   141 - 147
//

Text Mined References (79)

PMID Year Title
27442380 2015 Visualisation of Microglia with the use of Immunohistochemical Double Staining Method for CD-68 and Iba-1 of Cerebral Tissue Samples in Cases of Brain Contusions.
26585362 2016 Expression of allograft inflammatory factor-1 in peripheral blood monocytes and synovial membranes in patients with rheumatoid arthritis.
26324213 2015 Influence of AIF1 Gene Polymorphisms on Long-Term Kidney Allograft Function.
25998745 2015 Daintain/AIF-1 accelerates the activation of insulin-like growth factor-1 receptor signaling pathway in HepG2 cells.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
25026748 2013 [Association between AIF-1 gene polymorphisms and response to rheumatoid arthritis treatment with sulphasalazine].
24796669 2014 Allograft inflammatory factor-1 stimulates chemokine production and induces chemotaxis in human peripheral blood mononuclear cells.
24337893 2014 Allograft inflammatory factor-1 is an independent prognostic indicator that regulates ?-catenin in gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018427 2013 Effect of allograft inflammatory factor-1 gene polymorphisms on rheumatoid arthritis treatment with methotrexate.
More...