Property Summary

NCBI Gene PubMed Count 29
Grant Count 37
R01 Count 17
Funding $4,593,918.67
PubMed Score 68.43
PubTator Score 35.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer 1.600 0.004

Gene RIF (8)

PMID Text
23201136 Our characterization of alternative forms of MAGP2 present in the extracellular space not only enhances diversity of this ECM protein but also provides a previously unrecognized molecular mechanism for regulation of MAGP2 biological activity.
22885067 Decreased MFAP2 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that microfibrillar-associated protein 2 (MFAP2) is a Nef-binding protein in Jurkat cells
21540769 Demonstrate specific immunolocalization of fibrillin-1, MAGP-1, and LTBP-1 with elastin in the outer annulus fibrosus of the fetal human intravertebral disc.
19182256 Observational study of gene-disease association. (HuGE Navigator)
17692555 Study suggests a dual role for MAGP1, with extracellular MAGP1A involved in ECM function, and intracellular MAGP1B modulating the expression of genes that function in cell adhesion, migration and control of ECM deposition.
16492672 microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway
15233806 These results demonstrate that microfibril-associated glycoprotein-1 is capable of cumulative binding to distinct regions on tropoelastin, with different apparent dissociation constants and different amounts of bound protein.

AA Sequence

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV      1 - 70
QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT     71 - 140
VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC                               141 - 183
//

Text Mined References (30)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25406291 2014 Human eye development is characterized by coordinated expression of fibrillin isoforms.
24353434 2013 Investigation of age-related decline of microfibril-associated glycoprotein-1 in human skin through immunohistochemistry study.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23201136 2013 Identification of a functional proprotein convertase cleavage site in microfibril-associated glycoprotein 2.
22885067 2012 NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21540769 2011 Comparative immunolocalization of the elastin fiber-associated proteins fibrillin-1, LTBP-2, and MAGP-1 with components of the collagenous and proteoglycan matrix of the fetal human intervertebral disc.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...