Property Summary

NCBI Gene PubMed Count 37
PubMed Score 182.85
PubTator Score 202.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -4.400 1.8e-02
psoriasis 1.400 6.5e-05
Atopic dermatitis -1.900 3.6e-03

Gene RIF (26)

PMID Text
26905431 This supports the hypothesis that the antiproliferative activity of SLURP-1 is related to 'metabotropic' signaling pathway through alpha7-nAChR, that activates intracellular signaling cascades without opening the receptor channel.
26474319 SLURP1 participates in pathophysiology of psoriasis by regulating keratinocyte proliferation and differentiation, and by suppressing the growth of S. aureus
26254200 novel splice site mutation c.58+5G>T in mal de Meleda in India
25919322 Results of this study suggest understand Mal de Meleda, it will be important to identify proteins that interact with mutatated SLURP1. In any such studies, it will be important to assess binding of mutant SLURP1 proteins that cause Mal de Meleda.
24877120 rSLURP-1 decreased production of TNFalpha by T-cells, downregulated IL-1 beta and IL-6 secretion by macrophages, and moderately upregulated IL-10 production by both types of immunocytes
24738704 To our knowledge, the present study is the fi rst report on molecular investigation of Mal de Meleda from Libya.
24604124 Palmoplantar keratoderma of the Gamborg-Nielsen type is caused by mutations in the SLURP1 gene and represents a variant of Mal de Meleda.
24093092 This report further expands the spectrum of clinical phenotypes associated with mutations in SLURP1 in the Mediterranean population.
23876317 Those findings suggested that SLURP-1 and stimulus through alpha7 nicotinic ACh receptors actively controlled asthmatic condition by stimulating ciliary beating and also by suppressing airway inflammation.
23290002 mutations in SLURP1 as a cause for mal de Meleda and suggest an ancient founder effect for p.W15R in the western European population.
22369755 The pro-oncogenic effects of tobacco nitrosamine (4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone) can be abolished, in part, by rSLURP-1 that also upregulated RUNX3.
20854438 Patients with Mal de Meleda with the homozygous SLURP-1 G86R mutation may have an impaired T-cell activation
20660165 Results indicate that activation of alpha(7)-nAChR by SLURP-1 leads to upregulation of NF-kappaB gene expression due to activation of the Raf-1/MEK1/ERK1/2 cascade that proceeds via two complementary signaling pathways.
20621062 Those findings suggest that diminished expression of SLURP-1 in asthma attenuates its negative regulation of airway inflammation, and that perhaps changes in SLURP-1 expression could serve as a marker of airway damage in asthma.
20337899 These findings suggest that SLURP-1 may play an important role in the control and maintenance of the periodontal ligament by protecting the periodontal ligament fibroblasts from apoptosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19692209 these results expand the spectrum of mutations in SLURP-1 gene.
18764860 SLURP-1 participates in the regulation of gut immune functions and motility, as well as possibly playing a role in colon carcinogenesis/cancer progression.
17643396 anti-tumorigenic activities of SLURP-1 and -2 were demonstrated both in vitro and in vivo.
16354194 Biological role of SLURP-1 in the epidermis is to provide fine tuning of the physiologic regulation of keratinocyt functions through the cholinergic pathways.
15909066 Mutation analysis revealed a homozygous missense mutation (G86R) in exon 3 of ARS gene of this patient
14721776 ARS Component B and its protein product SLURP1 are implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
14506129 Identification of SLURP1 as an epidermal neurotransmitter explains the clinical phenotype of Mal de Meleda.
12787122 Recurrent nonsense mutation, R96X, in four families of Turkish descent. These families share common ancestral haplotype at mal de Meleda locus, suggesting founder effect.
12603845 Novel mutations in the gene encoding protein-SLURP-1 and 5 haplotypes in Mal de Meleda. Founder mutation, conserved cysteine residue to tyrosine (C99Y), in inbred pedigree, and a signal sequence mutation (W15R), homozygous and heterozygous.
12483299 Our findings indicate that the MDM type of transgressive PPK is caused by SLURP-1 mutations in patients from various origins and demonstrate allelic heterogeneity for mutations in SLURP-1.

AA Sequence

MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT      1 - 70
RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL                                          71 - 103
//

Text Mined References (38)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26905431 2016 Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Is a Selective Allosteric Antagonist of ?7 Nicotinic Acetylcholine Receptor.
26474319 2015 IL-22/STAT3-Induced Increases in SLURP1 Expression within Psoriatic Lesions Exerts Antimicrobial Effects against Staphylococcus aureus.
26254200 2015 A novel mutation in SLURP1 in patients with mal de Meleda from the Indian subcontinent.
25919322 2015 Heterogeneity in the properties of mutant secreted lymphocyte antigen 6/urokinase receptor-related protein 1 (SLURP1) in Mal de Meleda.
24877120 2014 Anti-inflammatory effects of the nicotinergic peptides SLURP-1 and SLURP-2 on human intestinal epithelial cells and immunocytes.
24738704 2015 The first Mal de Meleda case in Libya: identification of a SLURP1 mutation.
24604124 2014 Palmoplantar keratoderma of the Gamborg-Nielsen type is caused by mutations in the SLURP1 gene and represents a variant of Mal de Meleda.
24093092 2013 Particular Mal de Meleda phenotypes in Tunisia and mutations founder effect in the Mediterranean region.
23876317 2013 Effect of secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related peptide-1 (SLURP-1) on airway epithelial cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23290002 2013 Haplotype analysis in western European patients with mal de Meleda: founder effect for the W15R mutation in the SLURP1 gene.
22369755 2012 Reciprocal effects of NNK and SLURP-1 on oncogene expression in target epithelial cells.
20854438 2011 SLURP1 mutation-impaired T-cell activation in a family with mal de Meleda.
20660165 2010 Upregulation of nuclear factor-kappaB expression by SLURP-1 is mediated by alpha7-nicotinic acetylcholine receptor and involves both ionic events and activation of protein kinases.
20621062 2010 Down-regulation of secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related peptide-1 (SLURP-1), an endogenous allosteric alpha7 nicotinic acetylcholine receptor modulator, in murine and human asthmatic conditions.
20337899 2010 A novel molecule, SLURP-1, enhances the survival of periodontal ligament fibroblasts.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19692209 2009 Mutations in the SLURP-1 gene underlie Mal de Meleda in three Pakistani families.
18764860 2008 Expression of the endogenous, nicotinic acetylcholine receptor ligand, SLURP-1, in human colon cancer.
17643396 2007 Overexpression of SLURP-1 and -2 alleviates the tumorigenic action of tobacco-derived nitrosamine on immortalized oral epithelial cells.
17008884 2007 SLURP1 is a late marker of epidermal differentiation and is absent in Mal de Meleda.
16354194 2005 Biological effects of SLURP-1 on human keratinocytes.
15909066 2005 Mal de Meleda in a taiwanese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14756676 2004 Heterozygous manifestations in female carriers of Mal de Meleda.
14721776 ARS Component B: structural characterization, tissue expression and regulation of the gene and protein (SLURP-1) associated with Mal de Meleda.
14674887 2003 A novel missense mutation in the gene encoding SLURP-1 in patients with Mal de Meleda from northern Tunisia.
14506129 2003 Identification of SLURP-1 as an epidermal neuromodulator explains the clinical phenotype of Mal de Meleda.
12787122 2003 A recurrent mutation in the ARS (component B) gene encoding SLURP-1 in Turkish families with mal de Meleda: evidence of a founder effect.
12603845 2003 Novel mutations in the gene encoding secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related protein-1 (SLURP-1) and description of five ancestral haplotypes in patients with Mal de Meleda.
12483299 2003 Mal de Meleda (MDM) caused by mutations in the gene for SLURP-1 in patients from Germany, Turkey, Palestine, and the United Arab Emirates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11285253 2001 Mutations in the gene encoding SLURP-1 in Mal de Meleda.
10211827 1999 Structural and phylogenetic characterization of human SLURP-1, the first secreted mammalian member of the Ly-6/uPAR protein superfamily.
9887370 Genetic linkage of Meleda disease to chromosome 8qter.
8742060 1996 Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes.