Property Summary

NCBI Gene PubMed Count 37
Grant Count 75
R01 Count 59
Funding $11,198,029.01
PubMed Score 182.85
PubTator Score 202.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.018
psoriasis 1.400 0.000
Atopic dermatitis -1.900 0.004

Synonym

Accession P55000 Q53YJ6 Q6PUA6 Q92483 SLURP-1
Symbols ARS
MDM
ANUP
ArsB
LY6LS

Gene

PDB

2MUO   2MUP  

Gene RIF (26)

PMID Text
26905431 This supports the hypothesis that the antiproliferative activity of SLURP-1 is related to 'metabotropic' signaling pathway through alpha7-nAChR, that activates intracellular signaling cascades without opening the receptor channel.
26474319 SLURP1 participates in pathophysiology of psoriasis by regulating keratinocyte proliferation and differentiation, and by suppressing the growth of S. aureus
26254200 novel splice site mutation c.58+5G>T in mal de Meleda in India
25919322 Results of this study suggest understand Mal de Meleda, it will be important to identify proteins that interact with mutatated SLURP1. In any such studies, it will be important to assess binding of mutant SLURP1 proteins that cause Mal de Meleda.
24877120 rSLURP-1 decreased production of TNFalpha by T-cells, downregulated IL-1 beta and IL-6 secretion by macrophages, and moderately upregulated IL-10 production by both types of immunocytes
24738704 To our knowledge, the present study is the fi rst report on molecular investigation of Mal de Meleda from Libya.
24604124 Palmoplantar keratoderma of the Gamborg-Nielsen type is caused by mutations in the SLURP1 gene and represents a variant of Mal de Meleda.
24093092 This report further expands the spectrum of clinical phenotypes associated with mutations in SLURP1 in the Mediterranean population.
23876317 Those findings suggested that SLURP-1 and stimulus through alpha7 nicotinic ACh receptors actively controlled asthmatic condition by stimulating ciliary beating and also by suppressing airway inflammation.
23290002 mutations in SLURP1 as a cause for mal de Meleda and suggest an ancient founder effect for p.W15R in the western European population.
More...

AA Sequence

MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT      1 - 70
RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL                                          71 - 103
//

Text Mined References (38)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26905431 2016 Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Is a Selective Allosteric Antagonist of ?7 Nicotinic Acetylcholine Receptor.
26474319 2015 IL-22/STAT3-Induced Increases in SLURP1 Expression within Psoriatic Lesions Exerts Antimicrobial Effects against Staphylococcus aureus.
26254200 2015 A novel mutation in SLURP1 in patients with mal de Meleda from the Indian subcontinent.
25919322 2015 Heterogeneity in the properties of mutant secreted lymphocyte antigen 6/urokinase receptor-related protein 1 (SLURP1) in Mal de Meleda.
24877120 2014 Anti-inflammatory effects of the nicotinergic peptides SLURP-1 and SLURP-2 on human intestinal epithelial cells and immunocytes.
24738704 2015 The first Mal de Meleda case in Libya: identification of a SLURP1 mutation.
24604124 2014 Palmoplantar keratoderma of the Gamborg-Nielsen type is caused by mutations in the SLURP1 gene and represents a variant of Mal de Meleda.
24093092 2013 Particular Mal de Meleda phenotypes in Tunisia and mutations founder effect in the Mediterranean region.
23876317 2013 Effect of secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related peptide-1 (SLURP-1) on airway epithelial cells.
More...