Property Summary

NCBI Gene PubMed Count 9
Grant Count 28
R01 Count 20
Funding $3,677,281.5
PubMed Score 6.69
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.479 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.500 0.001
medulloblastoma, large-cell 1.500 0.000
non-small cell lung cancer -1.311 0.000
interstitial cystitis 1.300 0.002
adult high grade glioma 1.300 0.001
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.100 0.000
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
19407395 prerequisite for obtaining well diffracting crystals was the performance of X-ray fluorescence analysis on poorly diffracting apo hARH1 crystals, which revealed the presence of trace amounts of K(+) in the crystal
15546898 Silencing of the putative maternally imprinted tumor suppressor gene ARHI serves as a key early event in follicular thyroid carcinogenesis.

AA Sequence

MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEA      1 - 70
GKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGL     71 - 140
RFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSG    141 - 210
YFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYD    211 - 280
AVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSK    281 - 350
EDTVISL                                                                   351 - 357
//

Publication (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19407395 2009 Cloning, expression, purification and crystallization as well as X-ray fluorescence and preliminary X-ray diffraction analyses of human ADP-ribosylhydrolase 1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15546898 2005 Silencing of the maternally imprinted tumor suppressor ARHI contributes to follicular thyroid carcinogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070318 2002 The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse.
9193669 1997 The alpha 7 integrin as a target protein for cell surface mono-ADP-ribosylation in muscle cells.
8349667 1993 Cloning and site-directed mutagenesis of human ADP-ribosylarginine hydrolase.