Property Summary

NCBI Gene PubMed Count 38
PubMed Score 86.37
PubTator Score 141.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.9e-03
acute myeloid leukemia 783 8.8e-03
Disease Target Count Z-score Confidence
Hydrocephalus 152 3.79 1.9
Tetanus 68 3.41 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 8.8e-03
diabetes mellitus -1.300 1.9e-03

Gene RIF (9)

AA Sequence

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ      1 - 70
LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK     71 - 140
AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA    141 - 210
LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML    211 - 280
LRIKKTIQGDEEDLR                                                           281 - 295
//

Text Mined References (44)

PMID Year Title