Property Summary

NCBI Gene PubMed Count 38
Grant Count 67
R01 Count 32
Funding $12,090,669.37
PubMed Score 86.66
PubTator Score 141.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 0.002
acute myeloid leukemia 1.200 0.009

Synonym

Accession P54920 A8K879 Q96IK3 Q9BVJ3 SNAP-alpha
Symbols SNAPA

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
26156199 alphaSNAP is mainly expressed in the neuron brain tissue of patients with temporal lobe epilepsy. Its blood levels were significantly lower in these patients. alphaSNAP levels may increase epilepsy susceptibility.
24311785 data implicates beta1 integrin, FAK, and paxillin in mediating the observed pro-adhesive effects of alphaSNAP. These results reveal novel roles for alphaSNAP in regulating ECM adhesion and motility of epithelial cells.
23187805 Study revealed a novel role for alphaSNAP as a negative regulator of autophagy that acts by enhancing mTOR signaling and regulating the integrity of the Golgi complex.
22485163 novel roles for alphaSNAP in promoting the formation of epithelial adherens junctions and tight junctions by controlling golgi-dependent expression and trafficking of junctional proteins.
22194596 a novel role for alphaSNAP in promoting epithelial cell survival by unique mechanisms involving regulation of Bcl-2 expression and Golgi biogenesis
21931730 The most N-terminal part of BKV agnoprotein is involved in the interaction with alpha-SNAP
20089838 Results suggest that the combinational SNARE proteins VAMP8 and Vti1b mediate the fusion of antimicrobial and canonical autophagosomes with lysosomes, an essential event for autophagic degradation.
15980433 G alpha12 interaction with alphaSNAP induces VE-cadherin localization at endothelial junctions and regulates barrier function
15542541 alpha-SNAP plays a key role in the acrosome reaction.

AA Sequence

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ      1 - 70
LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK     71 - 140
AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA    141 - 210
LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML    211 - 280
LRIKKTIQGDEEDLR                                                           281 - 295
//

Text Mined References (44)

PMID Year Title
26156199 2015 Association of Alpha-Soluble NSF Attachment Protein with Epileptic Seizure.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24311785 2014 N-ethylmaleimide-sensitive factor attachment protein ? (?SNAP) regulates matrix adhesion and integrin processing in human epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23187805 2012 Loss of a membrane trafficking protein ?SNAP induces non-canonical autophagy in human epithelia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22485163 2012 A membrane fusion protein ?SNAP is a novel regulator of epithelial apical junctions.
More...