Property Summary

NCBI Gene PubMed Count 80
PubMed Score 61.51
PubTator Score 99.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.4e-05
psoriasis 6694 1.4e-05
Breast cancer 3578 2.1e-03
intraductal papillary-mucinous neoplasm (IPMN) 3291 1.2e-02
gastric carcinoma 807 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Prostate cancer 175 4.162 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.300 2.1e-03
gastric carcinoma -3.700 4.1e-02
intraductal papillary-mucinous neoplasm ... -2.500 1.2e-02
ovarian cancer 1.400 1.4e-05
psoriasis -1.500 1.4e-05

Gene RIF (64)

AA Sequence

MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSS      1 - 70
AIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMK     71 - 140
LQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFME    141 - 210
RIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG    211 - 280
LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS    281 - 350
NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT    351 - 420
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH    421 - 490
SLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD                                  491 - 530
//

Text Mined References (83)

PMID Year Title