Property Summary

NCBI Gene PubMed Count 74
Grant Count 27
R01 Count 17
Funding $3,303,800.61
PubMed Score 60.19
PubTator Score 99.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -2.500 0.012
Breast cancer -1.300 0.002
gastric carcinoma -3.700 0.041
ovarian cancer 1.400 0.000
psoriasis -1.500 0.000

Gene RIF (58)

PMID Text
26385605 miR-376c is inversely linked to UGT2B15 and UGT2B17 expression in high-grade prostate cancer and metastasis.UGT2B15 and UGT2B17 genes are direct targets of miR-376c and thus may influence steroid metabolism during prostate cancer progression.
26238215 CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26163549 Expression of UGT2B15 and UGT2B17 is negatively regulated by the binding of miR-376c.
25795461 Data suggest that both 17beta-estradiol and the antiestrogen 4-OHTAM (4-hydroxytamoxifen, a metabolite of tamoxifen and substrate of UGT2B15) up-regulate UGT2B15 in breast cancer cells via the same estrogen receptor alpha- (ERa-)signaling pathway.
24980262 Hepatic UGT2B15 protein onset begins in late gestation; however, the greatest rate of change occurs during the first few weeks after birth.
24822274 A haplotype in UGT2B15 containing a functional variant (rs4148269, K523T) and an intronic SNP (rs6837575) was found to affect rectal cancer risk overall (OR = 2.57, 95% CI = 1.21-5.04) and in females (OR = 3.08, 95% CI = 1.08-8.74).
24267955 Novel associations between UGT2B15 and UGT2B17 single nucleotide polymorphism variants and prostate cancer risk.
24214217 UGT2B15 genotype is a major determinant for differences in fasting plasma glucose and HbA1c response to sipoglitazar treatment between Type 2 Diabetes mellitus patients, due to related differences in drug exposure.
24121496 UGT2B15 is a possible target for androgen deprivation therapy of prostate cancer.
More...

AA Sequence

MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSS      1 - 70
AIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMK     71 - 140
LQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFME    141 - 210
RIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG    211 - 280
LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS    281 - 350
NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT    351 - 420
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH    421 - 490
SLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD                                  491 - 530
//

Publication (77)

PMID Year Title
26385605 2016 Epigenetic regulation of steroid inactivating UDP-glucuronosyltransferases by microRNAs in prostate cancer.
26238215 2015 Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26163549 2015 Regulation of Human UGT2B15 and UGT2B17 by miR-376c in Prostate Cancer Cell Lines.
25795461 2015 Induction of UDP-glucuronosyltransferase 2B15 gene expression by the major active metabolites of tamoxifen, 4-hydroxytamoxifen and endoxifen, in breast cancer cells.
24980262 2014 Human hepatic UGT2B15 developmental expression.
24822274 2014 The effect of UGT1A and UGT2B polymorphisms on colorectal cancer risk: haplotype associations and gene–environment interactions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24267955 2013 Novel associations of UDP-glucuronosyltransferase 2B gene variants with prostate cancer risk in a multiethnic study.
24214217 2014 A model-based approach to analyze the influence of UGT2B15 polymorphism driven pharmacokinetic differences on the pharmacodynamic response of the PPAR agonist sipoglitazar.
More...