Property Summary

NCBI Gene PubMed Count 21
PubMed Score 44.76
PubTator Score 24.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P54852 Q6FH01 EMP-3
Symbols YMP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
26472188 The study provided a new insight into EMP3, suggesting that EMP3 enhances malignancy of hepatocellular carcinoma cells
26398721 EMP3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma.
24083241 The aim of this study was to investigate the EMP3 promoter hypermethylation status in a series of 229 astrocytic and oligodendroglial tumors and in 16 glioblastoma cell lines.
23920144 Decreased expression of EMP3 by promoter methylation is associated by lung cancer
22992787 LOH 19q determines the complete loss of EMP3 function, as the conserved allele is frequently hypermethylated, and this may represent the molecular basis of the higher risk of relapse in this subgroup of grade II oligodendroglioma patients.
20388442 The promoter methylation and mRNA expressions of EMP3 and PCDH-gamma-A11 are closely related with the malignant development of glioma.
19270820 Epithelial membrane protein 3 overexpression in breast carcinomas was significantly related to histological grade III , lymph node metastasis , and strong Her-2 expression.
18823699 Loss of EMP3 is associated with esophageal squamous cell carcinoma.
17610521 Oligodendroglial and astrocytic gliomas show EMP3 hypermethylation and aberrant expression. Primary and secondary glioblastomas have distinct genetic profiles and also differ in their epigenetic aberrations.
17187361 EMP3 overexpression is associated with oligodendroglial tumors
16015083 The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques
15583422 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM      1 - 70
VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA     71 - 140
LAWVAFPLALVSGIIYIHLRKRE                                                   141 - 163
//

Text Mined References (21)

PMID Year Title
26472188 2015 Targeting EMP3 suppresses proliferation and invasion of hepatocellular carcinoma cells through inactivation of PI3K/Akt pathway.
26398721 2015 Epithelial membrane protein 3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24083241 2013 Promoter hypermethylation of the EMP3 gene in a series of 229 human gliomas.
23920144 2013 Epithelial membrane protein 3 is frequently shown as promoter methylation and functions as a tumor suppressor gene in non-small cell lung cancer.
22992787 2012 LOH 19q indicates shorter disease progression-free interval in low-grade oligodendrogliomas with EMP3 methylation.
20388442 2010 [The methylation analysis of EMP3 and PCDH-gamma-A11 gene in human glioma].
19270820 2009 EMP3 overexpression in primary breast carcinomas is not associated with epigenetic aberrations.
18823699 2009 EMP3 as a tumor suppressor gene for esophageal squamous cell carcinoma.
17610521 2007 DNA hypermethylation and aberrant expression of the EMP3 gene at 19q13.3 in Human Gliomas.
17187361 2007 EMP3 overexpression is associated with oligodendroglial tumors retaining chromosome arms 1p and 19q.
16015083 2005 Altered expression of CLC, DSG3, EMP3, S100A2, and SLPI in corneal epithelium from keratoconus patients.
15583422 2004 Analysis of candidate genes for prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107182 2002 Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus.
10331954 1999 Regional localization of the human epithelial membrane protein genes 1, 2, and 3 (EMP1, EMP2, EMP3) to 12p12.3, 16p13.2, and 19q13.3.
9204931 1997 HNMP-1: a novel hematopoietic and neural membrane protein differentially regulated in neural development and injury.
8996089 1996 Characterization of a tumor-associated gene, a member of a novel family of genes encoding membrane glycoproteins.
8917086 1996 Epithelial membrane protein-2 and epithelial membrane protein-3: two novel members of the peripheral myelin protein 22 gene family.
8884260 1996 Identification and characterization of a cDNA and the structural gene encoding the mouse epithelial membrane protein-1.