Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
Funding $902,635
PubMed Score 44.76
PubTator Score 24.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26472188 The study provided a new insight into EMP3, suggesting that EMP3 enhances malignancy of hepatocellular carcinoma cells
26398721 EMP3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma.
24083241 The aim of this study was to investigate the EMP3 promoter hypermethylation status in a series of 229 astrocytic and oligodendroglial tumors and in 16 glioblastoma cell lines.
23920144 Decreased expression of EMP3 by promoter methylation is associated by lung cancer
22992787 LOH 19q determines the complete loss of EMP3 function, as the conserved allele is frequently hypermethylated, and this may represent the molecular basis of the higher risk of relapse in this subgroup of grade II oligodendroglioma patients.
20388442 The promoter methylation and mRNA expressions of EMP3 and PCDH-gamma-A11 are closely related with the malignant development of glioma.
19270820 Epithelial membrane protein 3 overexpression in breast carcinomas was significantly related to histological grade III , lymph node metastasis , and strong Her-2 expression.
18823699 Loss of EMP3 is associated with esophageal squamous cell carcinoma.
17610521 Oligodendroglial and astrocytic gliomas show EMP3 hypermethylation and aberrant expression. Primary and secondary glioblastomas have distinct genetic profiles and also differ in their epigenetic aberrations.
17187361 EMP3 overexpression is associated with oligodendroglial tumors
More...

AA Sequence

MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM      1 - 70
VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA     71 - 140
LAWVAFPLALVSGIIYIHLRKRE                                                   141 - 163
//

Publication (21)

PMID Year Title
26472188 2015 Targeting EMP3 suppresses proliferation and invasion of hepatocellular carcinoma cells through inactivation of PI3K/Akt pathway.
26398721 2015 Epithelial membrane protein 3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24083241 2013 Promoter hypermethylation of the EMP3 gene in a series of 229 human gliomas.
23920144 2013 Epithelial membrane protein 3 is frequently shown as promoter methylation and functions as a tumor suppressor gene in non-small cell lung cancer.
22992787 2012 LOH 19q indicates shorter disease progression-free interval in low-grade oligodendrogliomas with EMP3 methylation.
20388442 2010 [The methylation analysis of EMP3 and PCDH-gamma-A11 gene in human glioma].
19270820 2009 EMP3 overexpression in primary breast carcinomas is not associated with epigenetic aberrations.
18823699 2009 EMP3 as a tumor suppressor gene for esophageal squamous cell carcinoma.
17610521 2007 DNA hypermethylation and aberrant expression of the EMP3 gene at 19q13.3 in Human Gliomas.
More...