Property Summary

NCBI Gene PubMed Count 36
Grant Count 52
R01 Count 31
Funding $7,234,487.43
PubMed Score 203.09
PubTator Score 39.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
25940704 EMP2 plays a tumor suppressor role by inducing G2/M cell cycle arrest, suppressing cell viability, proliferation, colony formation/ anchorage-independent cell growth via regulation of G2/M checkpoints in distinct-derived cell lines.
25684502 Loss of EMP2 is associated with nasopharyngeal carcinoma.
24814193 We showed that knockdown of EMP2 in podocytes and endothelial cells resulted in an increased amount of CAVEOLIN-1 and decreased cell proliferation, so EMP2 mutations causes a recessive Mendelian form of steroid-sensitive nephrotic syndrome.
24644285 the role of EMP2 in the pathogenesis of GBM a
23838430 EMP2 was identified as a tumor-suppressor gene in urinary tract urothelial carcinoma.
23334331 support the role of EMP2 in the control of the tumor microenvironment and confirm the cytotoxic effects observed by EMP2 treatment in vivo
21637765 Manipulation of EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, and promotes their distribution into lipid raft domains.
20670949 EMP2 is expressed in the majority of ovarian tumors and may be a feasible target in vivo.
19010852 EMP2 may be a potential pharmacologic target for human endometrial cancer.
More...

AA Sequence

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL      1 - 70
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG     71 - 140
YSYILAWVAFACTFISGMMYLILRKRK                                               141 - 167
//

Publication (36)

PMID Year Title
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
25940704 2015 The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma.
25684502 2015 Immunohistochemical expression of cytokeratins and epithelial membrane protein 2 in nasopharyngeal carcinoma and its potential implications.
24814193 2014 Mutations in EMP2 cause childhood-onset nephrotic syndrome.
24644285 2014 Epithelial membrane protein-2 (EMP2) activates Src protein and is a novel therapeutic target for glioblastoma.
24448822 2014 Rationale and preclinical efficacy of a novel anti-EMP2 antibody for the treatment of invasive breast cancer.
23838430 2013 Epithelial membrane protein 2 is a prognostic indictor for patients with urothelial carcinoma of the upper urinary tract.
23568457 2013 Genetic variants associated with disordered eating.
23439602 2013 Epithelial membrane protein 2 controls VEGF expression in ARPE-19 cells.
23334331 2013 EMP2 regulates angiogenesis in endometrial cancer cells through induction of VEGF.
More...