Property Summary

NCBI Gene PubMed Count 36
PubMed Score 203.09
PubTator Score 39.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 2.79243320824068E-27
lung carcinoma 2844 8.04567172960078E-26
lung adenocarcinoma 2714 9.1003632219906E-17
posterior fossa group A ependymoma 1511 3.01653081048768E-11
pilocytic astrocytoma 3086 9.21442863346605E-9
Breast cancer 3099 4.10897999563834E-8
pituitary cancer 1972 1.49178782252068E-7
interstitial cystitis 2299 1.1727709582705E-5
osteosarcoma 7933 1.53926473472177E-5
nephrosclerosis 329 4.18557440713818E-5
lung cancer 4473 7.68666753759194E-5
astrocytic glioma 2241 5.75960818387636E-4
primary pancreatic ductal adenocarcinoma 1271 0.00106324150243485
ovarian cancer 8492 0.00258696083382459
sonic hedgehog group medulloblastoma 1482 0.00284029425416771
psoriasis 6685 0.0035331557612448
pancreatic cancer 2300 0.00625891243568107
glioblastoma 5572 0.00951826174686907
intraductal papillary-mucinous adenoma (IPMA) 2956 0.016740527419013
aldosterone-producing adenoma 664 0.0182730945674819
oligodendroglioma 2849 0.0211443543410216
cutaneous lupus erythematosus 1056 0.0251598034971867
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0256330173492189
mucosa-associated lymphoid tissue lymphoma 480 0.0267063668037488
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0312187626838695
spina bifida 1064 0.0458977361311681
esophageal adenocarcinoma 737 0.0491111762907031
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Proliferative vitreoretinopathy 17 3.996 2.0
Disease Target Count
NEPHROTIC SYNDROME, TYPE 10 1
Disease Target Count
Nephrotic syndrome 10 1

Expression

Synonym

Accession P54851 B2R7V6 D3DUF8 EMP-2
Symbols XMP

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Gene RIF (16)

PMID Text
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
25940704 EMP2 plays a tumor suppressor role by inducing G2/M cell cycle arrest, suppressing cell viability, proliferation, colony formation/ anchorage-independent cell growth via regulation of G2/M checkpoints in distinct-derived cell lines.
25684502 Loss of EMP2 is associated with nasopharyngeal carcinoma.
24814193 We showed that knockdown of EMP2 in podocytes and endothelial cells resulted in an increased amount of CAVEOLIN-1 and decreased cell proliferation, so EMP2 mutations causes a recessive Mendelian form of steroid-sensitive nephrotic syndrome.
24644285 the role of EMP2 in the pathogenesis of GBM a
23838430 EMP2 was identified as a tumor-suppressor gene in urinary tract urothelial carcinoma.
23334331 support the role of EMP2 in the control of the tumor microenvironment and confirm the cytotoxic effects observed by EMP2 treatment in vivo
21637765 Manipulation of EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, and promotes their distribution into lipid raft domains.
20670949 EMP2 is expressed in the majority of ovarian tumors and may be a feasible target in vivo.
19010852 EMP2 may be a potential pharmacologic target for human endometrial cancer.
More...

AA Sequence

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL      1 - 70
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG     71 - 140
YSYILAWVAFACTFISGMMYLILRKRK                                               141 - 167
//

Text Mined References (36)

PMID Year Title
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
25940704 2015 The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma.
25684502 2015 Immunohistochemical expression of cytokeratins and epithelial membrane protein 2 in nasopharyngeal carcinoma and its potential implications.
24814193 2014 Mutations in EMP2 cause childhood-onset nephrotic syndrome.
24644285 2014 Epithelial membrane protein-2 (EMP2) activates Src protein and is a novel therapeutic target for glioblastoma.
24448822 2014 Rationale and preclinical efficacy of a novel anti-EMP2 antibody for the treatment of invasive breast cancer.
23838430 2013 Epithelial membrane protein 2 is a prognostic indictor for patients with urothelial carcinoma of the upper urinary tract.
23568457 2013 Genetic variants associated with disordered eating.
23439602 2013 Epithelial membrane protein 2 controls VEGF expression in ARPE-19 cells.
23334331 2013 EMP2 regulates angiogenesis in endometrial cancer cells through induction of VEGF.
More...