Property Summary

NCBI Gene PubMed Count 41
PubMed Score 210.60
PubTator Score 39.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
aldosterone-producing adenoma -1.105 1.8e-02
astrocytic glioma -1.100 2.0e-02
Astrocytoma, Pilocytic 1.700 2.5e-06
Breast cancer 1.200 4.1e-08
cutaneous lupus erythematosus -1.300 2.5e-02
ependymoma 1.200 3.2e-05
esophageal adenocarcinoma -1.500 4.9e-02
glioblastoma 1.100 9.5e-03
interstitial cystitis -1.200 1.3e-03
intraductal papillary-mucinous adenoma (... 1.100 1.7e-02
intraductal papillary-mucinous carcinoma... 1.200 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.1e-02
lung adenocarcinoma -1.400 1.6e-14
lung cancer -3.100 7.7e-05
lung carcinoma -1.700 8.0e-26
mucosa-associated lymphoid tissue lympho... 1.608 2.7e-02
nephrosclerosis 1.174 4.2e-05
non-small cell lung cancer -2.091 7.0e-24
oligodendroglioma -1.100 4.7e-02
osteosarcoma 1.572 1.5e-05
ovarian cancer 1.200 2.6e-03
pancreatic cancer 1.400 6.3e-03
pituitary cancer -1.300 1.1e-05
primary pancreatic ductal adenocarcinoma 1.651 1.1e-03
psoriasis -1.200 3.5e-03
sonic hedgehog group medulloblastoma 1.100 2.8e-03
spina bifida -1.342 4.6e-02

Gene RIF (21)

AA Sequence

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL      1 - 70
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG     71 - 140
YSYILAWVAFACTFISGMMYLILRKRK                                               141 - 167
//

Text Mined References (41)

PMID Year Title