Property Summary

NCBI Gene PubMed Count 29
Grant Count 32
R01 Count 14
Funding $5,922,066.19
PubMed Score 356.05
PubTator Score 210.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Endobronchial lipoma 1 5.405 2.7
Rickets 42 5.181 2.6
Hypophosphatemia 31 4.869 2.4
Osteomalacia 28 4.691 2.3
Hyperparathyroidism 43 4.055 2.0
Hyperphosphatemia 32 3.365 1.7
Kidney disease 396 3.05 1.5
Breast cancer 3,094
Down syndrome 548
Duchenne muscular dystrophy 602
Hydrolethalus syndrome 128
Prostatic Neoplasms 471
Spontaneous abortion 108
active Crohn's disease 918
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cystic fibrosis 1,665
dermatomyositis 933
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
fascioscapulohumeral muscular dystrophy 100
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
spina bifida 1,064
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (44)

Disease log2 FC p
malignant mesothelioma -4.000 0.000
esophageal adenocarcinoma -3.100 0.030
psoriasis -1.100 0.012
astrocytoma 3.100 0.006
glioblastoma 4.400 0.001
oligodendroglioma 1.200 0.001
osteosarcoma 1.395 0.042
posterior fossa group A ependymoma 2.400 0.000
cystic fibrosis 1.367 0.000
atypical teratoid / rhabdoid tumor 1.400 0.028
medulloblastoma, large-cell -1.900 0.001
active Crohn's disease -1.720 0.039
ulcerative colitis -1.500 0.004
Duchenne muscular dystrophy 1.741 0.000
limb girdle muscular dystrophy 2A 1.397 0.000
autosomal dominant Emery-Dreifuss muscul... 2.304 0.000
fascioscapulohumeral muscular dystrophy 1.380 0.001
juvenile dermatomyositis 1.417 0.000
adrenocortical carcinoma -1.250 0.021
tuberculosis -3.200 0.000
primary pancreatic ductal adenocarcinoma 3.008 0.000
non-small cell lung cancer -1.597 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.003
intraductal papillary-mucinous carcinoma... -3.300 0.003
Hydrolethalus syndrome 1.928 0.028
lung cancer -4.300 0.000
interstitial cystitis 1.300 0.000
lung adenocarcinoma -1.400 0.000
pediatric high grade glioma 2.200 0.001
group 4 medulloblastoma -1.900 0.010
pilocytic astrocytoma 2.800 0.000
subependymal giant cell astrocytoma 1.988 0.027
Breast cancer -2.400 0.000
invasive ductal carcinoma -2.900 0.001
lung carcinoma -2.100 0.000
breast carcinoma -1.300 0.000
spina bifida -1.607 0.049
gastric carcinoma 2.800 0.006
ductal carcinoma in situ -2.400 0.000
ovarian cancer 2.100 0.006
pituitary cancer -2.300 0.000
Down syndrome 1.300 0.017
pancreatic cancer 3.000 0.000
dermatomyositis 2.100 0.005

Gene RIF (17)

PMID Text
25394671 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.EMP1 localises to tight junctions and is essential for their formation and function.
24920167 Results demonstrated that EMP1 protein levels were significantly reduced in gastric carcinoma and were associated with tumor invasion, lymph node metastasis, clinical stage and cell differentiation.
24744589 Low EMP1 expression in colorectal cancer is associated with increased disease severity, suggesting that EMP1 may be a negative regulator of colorectal cancer
24625531 EMP1 as an independent predictor for poor outcome in precursor-B ALL (BCP-ALL) (P=0.004, hazard ratio: 2.36 (1.31-4.25).
24402572 EMP1 may play important roles as a negative regulator to breast cancer MCF-7 cell by regulating the expression of caspase 9 and VEGFC protein.
24338711 EMP1 expression decreased in prostate cancer and correlated significantly T stages, lymph node metastasis, clinic stage, and Gleason score
24292952 EMP1 may play important roles as a negative regulator to nasopharyngeal cancer cell.
24033346 EMP1 could be a biomarker for aberrant epithelial remodelling and metaplasia in chronic inflammatory upper airway mucosa
23271282 EMP-1 was significantly up-regulated in NSCLC patients.
21538935 Overexpression of EMP1 in spinal chondrocytes promotes cell proliferation and survival, alters cell morphology and cell cycle, reduces cell condensation, and inhibits cell hypertrophy.
More...

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL      1 - 70
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC     71 - 140
FCFSFIIGVLYLVLRKK                                                         141 - 157
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25394671 2015 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.
24920167 2014 Association of EMP1 with gastric carcinoma invasion, survival and prognosis.
24744589 2014 Epithelial membrane protein 1 negatively regulates cell growth and metastasis in colorectal carcinoma.
24625531 2014 EMP1, a novel poor prognostic factor in pediatric leukemia regulates prednisolone resistance, cell proliferation, migration and adhesion.
24402572 2014 EMP1, a member of a new family of antiproliferative genes in breast carcinoma.
24338711 2014 EMP1 regulates caspase-9 and VEGFC expression and suppresses prostate cancer cell proliferation and invasion.
24292952 2014 EMP1 inhibits nasopharyngeal cancer cell growth and metastasis through induction apoptosis and angiogenesis.
24033346 2013 Down-regulation of EMP1 is associated with epithelial hyperplasia and metaplasia in nasal polyps.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
More...