Property Summary

NCBI Gene PubMed Count 29
PubMed Score 356.05
PubTator Score 210.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 2.08219020497809E-35
breast carcinoma 1614 3.68081447005159E-18
lung carcinoma 2844 1.79321455734642E-11
juvenile dermatomyositis 1189 1.15235110591336E-10
non-small cell lung cancer 2798 2.49399606961298E-9
malignant mesothelioma 3163 2.63118573676359E-9
posterior fossa group A ependymoma 1511 5.43577174919691E-9
Duchenne muscular dystrophy 602 1.23342574571453E-8
pilocytic astrocytoma 3086 1.90562475352995E-7
lung cancer 4473 6.26439207128947E-7
cystic fibrosis 1670 5.41957063916137E-6
lung adenocarcinoma 2714 2.89597113371755E-5
pituitary cancer 1972 3.35214348456341E-5
limb girdle muscular dystrophy 2A 156 5.61059394621358E-5
tuberculosis 1563 2.30011411219145E-4
pancreatic cancer 2300 2.64482287028371E-4
ductal carcinoma in situ 1745 2.73696376180889E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 3.22596371129729E-4
interstitial cystitis 2299 3.73900047720859E-4
primary pancreatic ductal adenocarcinoma 1271 4.87829491486644E-4
fascioscapulohumeral muscular dystrophy 100 5.51460579682023E-4
pediatric high grade glioma 2712 7.32232593209576E-4
glioblastoma 5572 9.9065090055663E-4
invasive ductal carcinoma 2950 0.00102228400093923
oligodendroglioma 2849 0.00106610856344063
medulloblastoma, large-cell 6234 0.00135671354521087
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00272414169616443
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00306551010217218
ulcerative colitis 2087 0.00376532013773497
dermatomyositis 967 0.00451623036662581
astrocytoma 1493 0.00566349143317631
gastric carcinoma 832 0.00613424846904358
ovarian cancer 8492 0.00627704951065141
group 4 medulloblastoma 1875 0.0098730279078281
psoriasis 6685 0.0124798814379784
Down syndrome 548 0.0174958773954177
adrenocortical carcinoma 1427 0.021265433303928
subependymal giant cell astrocytoma 2287 0.0267547959396513
Hydrolethalus syndrome 128 0.0283288953415756
atypical teratoid / rhabdoid tumor 4369 0.0284234274849156
esophageal adenocarcinoma 737 0.0296921663028672
active Crohn's disease 918 0.0390716165867086
osteosarcoma 7933 0.0419370476129564
spina bifida 1064 0.0493654092080356

Expression

  Differential Expression (44)

Disease log2 FC p
malignant mesothelioma -4.000 0.000
esophageal adenocarcinoma -3.100 0.030
psoriasis -1.100 0.012
astrocytoma 3.100 0.006
glioblastoma 4.400 0.001
oligodendroglioma 1.200 0.001
osteosarcoma 1.395 0.042
posterior fossa group A ependymoma 2.400 0.000
cystic fibrosis 1.367 0.000
atypical teratoid / rhabdoid tumor 1.400 0.028
medulloblastoma, large-cell -1.900 0.001
active Crohn's disease -1.720 0.039
ulcerative colitis -1.500 0.004
Duchenne muscular dystrophy 1.741 0.000
limb girdle muscular dystrophy 2A 1.397 0.000
autosomal dominant Emery-Dreifuss muscul... 2.304 0.000
fascioscapulohumeral muscular dystrophy 1.380 0.001
juvenile dermatomyositis 1.417 0.000
adrenocortical carcinoma -1.250 0.021
tuberculosis -3.200 0.000
primary pancreatic ductal adenocarcinoma 3.008 0.000
non-small cell lung cancer -1.597 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.003
intraductal papillary-mucinous carcinoma... -3.300 0.003
Hydrolethalus syndrome 1.928 0.028
lung cancer -4.300 0.000
interstitial cystitis 1.300 0.000
lung adenocarcinoma -1.400 0.000
pediatric high grade glioma 2.200 0.001
group 4 medulloblastoma -1.900 0.010
pilocytic astrocytoma 2.800 0.000
subependymal giant cell astrocytoma 1.988 0.027
Breast cancer -2.400 0.000
invasive ductal carcinoma -2.900 0.001
lung carcinoma -2.100 0.000
breast carcinoma -1.300 0.000
spina bifida -1.607 0.049
gastric carcinoma 2.800 0.006
ductal carcinoma in situ -2.400 0.000
ovarian cancer 2.100 0.006
pituitary cancer -2.300 0.000
Down syndrome 1.300 0.017
pancreatic cancer 3.000 0.000
dermatomyositis 2.100 0.005

Synonym

Accession P54849 B2R5N1 B4DRR1 O00681 Q13481 Q13834 EMP-1
Symbols TMP
CL-20
EMP-1

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Gene RIF (17)

PMID Text
25394671 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.EMP1 localises to tight junctions and is essential for their formation and function.
24920167 Results demonstrated that EMP1 protein levels were significantly reduced in gastric carcinoma and were associated with tumor invasion, lymph node metastasis, clinical stage and cell differentiation.
24744589 Low EMP1 expression in colorectal cancer is associated with increased disease severity, suggesting that EMP1 may be a negative regulator of colorectal cancer
24625531 EMP1 as an independent predictor for poor outcome in precursor-B ALL (BCP-ALL) (P=0.004, hazard ratio: 2.36 (1.31-4.25).
24402572 EMP1 may play important roles as a negative regulator to breast cancer MCF-7 cell by regulating the expression of caspase 9 and VEGFC protein.
24338711 EMP1 expression decreased in prostate cancer and correlated significantly T stages, lymph node metastasis, clinic stage, and Gleason score
24292952 EMP1 may play important roles as a negative regulator to nasopharyngeal cancer cell.
24033346 EMP1 could be a biomarker for aberrant epithelial remodelling and metaplasia in chronic inflammatory upper airway mucosa
23271282 EMP-1 was significantly up-regulated in NSCLC patients.
21538935 Overexpression of EMP1 in spinal chondrocytes promotes cell proliferation and survival, alters cell morphology and cell cycle, reduces cell condensation, and inhibits cell hypertrophy.
More...

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL      1 - 70
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC     71 - 140
FCFSFIIGVLYLVLRKK                                                         141 - 157
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25394671 2015 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.
24920167 2014 Association of EMP1 with gastric carcinoma invasion, survival and prognosis.
24744589 2014 Epithelial membrane protein 1 negatively regulates cell growth and metastasis in colorectal carcinoma.
24625531 2014 EMP1, a novel poor prognostic factor in pediatric leukemia regulates prednisolone resistance, cell proliferation, migration and adhesion.
24402572 2014 EMP1, a member of a new family of antiproliferative genes in breast carcinoma.
24338711 2014 EMP1 regulates caspase-9 and VEGFC expression and suppresses prostate cancer cell proliferation and invasion.
24292952 2014 EMP1 inhibits nasopharyngeal cancer cell growth and metastasis through induction apoptosis and angiogenesis.
24033346 2013 Down-regulation of EMP1 is associated with epithelial hyperplasia and metaplasia in nasal polyps.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
More...