Property Summary

NCBI Gene PubMed Count 30
PubMed Score 387.72
PubTator Score 210.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
breast carcinoma 1638 3.7e-13
lung carcinoma 2843 1.8e-11
astrocytoma 1146 9.7e-11
juvenile dermatomyositis 1187 1.2e-10
non-small cell lung cancer 2890 2.5e-09
malignant mesothelioma 3232 2.6e-09
Duchenne muscular dystrophy 601 1.2e-08
lung adenocarcinoma 2716 1.4e-07
Astrocytoma, Pilocytic 3081 1.9e-07
lung cancer 4740 8.5e-06
cystic fibrosis 1696 2.3e-05
pituitary cancer 1972 3.4e-05
limb girdle muscular dystrophy 2A 213 5.6e-05
ependymoma 4679 5.7e-05
tuberculosis 2010 2.3e-04
pancreatic cancer 2398 2.6e-04
autosomal dominant Emery-Dreifuss muscular dystrophy 510 3.2e-04
glioblastoma 5792 3.3e-04
interstitial cystitis 2312 3.7e-04
primary pancreatic ductal adenocarcinoma 1109 4.9e-04
fascioscapulohumeral muscular dystrophy 100 5.5e-04
oligodendroglioma 2850 1.1e-03
adult high grade glioma 3801 1.3e-03
medulloblastoma, large-cell 6241 1.4e-03
ductal carcinoma in situ 1745 1.8e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 2.7e-03
invasive ductal carcinoma 2951 2.8e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 3.1e-03
dermatomyositis 966 4.5e-03
group 4 medulloblastoma 1855 9.9e-03
ulcerative colitis 1819 1.0e-02
psoriasis 6694 1.2e-02
Breast cancer 3578 1.5e-02
Down syndrome 499 1.7e-02
ovarian cancer 8520 1.9e-02
adrenocortical carcinoma 1428 2.1e-02
esophageal adenocarcinoma 737 2.5e-02
subependymal giant cell astrocytoma 2287 2.7e-02
gastric carcinoma 807 2.7e-02
Hydrolethalus syndrome 128 2.8e-02
atypical teratoid / rhabdoid tumor 5112 2.8e-02
active Crohn's disease 922 3.9e-02
osteosarcoma 7950 4.2e-02
spina bifida 1074 4.9e-02

Expression

  Differential Expression (44)

Disease log2 FC p
active Crohn's disease -1.720 3.9e-02
adrenocortical carcinoma -1.250 2.1e-02
adult high grade glioma 2.100 1.3e-03
astrocytoma 1.900 9.7e-11
Astrocytoma, Pilocytic 2.800 1.9e-07
atypical teratoid / rhabdoid tumor 1.400 2.8e-02
autosomal dominant Emery-Dreifuss muscul... 2.304 3.2e-04
Breast cancer -1.300 1.5e-02
breast carcinoma -1.100 3.7e-13
cystic fibrosis 1.332 2.3e-05
dermatomyositis 2.100 4.5e-03
Down syndrome 1.300 1.7e-02
Duchenne muscular dystrophy 1.741 1.2e-08
ductal carcinoma in situ -1.400 1.8e-03
ependymoma 1.900 5.7e-05
esophageal adenocarcinoma -2.500 2.5e-02
fascioscapulohumeral muscular dystrophy 1.380 5.5e-04
gastric carcinoma 2.300 2.7e-02
glioblastoma 2.000 3.3e-04
group 4 medulloblastoma -1.900 9.9e-03
Hydrolethalus syndrome 1.928 2.8e-02
interstitial cystitis 1.300 3.7e-04
intraductal papillary-mucinous adenoma (... -3.000 3.1e-03
intraductal papillary-mucinous carcinoma... -3.300 2.7e-03
invasive ductal carcinoma -1.175 2.8e-03
juvenile dermatomyositis 1.417 1.2e-10
limb girdle muscular dystrophy 2A 1.397 5.6e-05
lung adenocarcinoma -1.200 1.4e-07
lung cancer -2.400 8.5e-06
lung carcinoma -2.100 1.8e-11
malignant mesothelioma -4.000 2.6e-09
medulloblastoma, large-cell -1.900 1.4e-03
non-small cell lung cancer -1.597 2.5e-09
oligodendroglioma 1.200 1.1e-03
osteosarcoma 1.395 4.2e-02
ovarian cancer -1.600 1.9e-02
pancreatic cancer 3.000 2.6e-04
pituitary cancer -2.300 3.4e-05
primary pancreatic ductal adenocarcinoma 3.008 4.9e-04
psoriasis -1.100 1.2e-02
spina bifida -1.607 4.9e-02
subependymal giant cell astrocytoma 1.988 2.7e-02
tuberculosis -3.200 2.3e-04
ulcerative colitis -1.216 1.0e-02

Gene RIF (18)

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL      1 - 70
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC     71 - 140
FCFSFIIGVLYLVLRKK                                                         141 - 157
//

Text Mined References (32)

PMID Year Title