Property Summary

Ligand Count 10
NCBI Gene PubMed Count 25
PubMed Score 70.76
PubTator Score 20.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 3.6e-03
astrocytic glioma -1.600 3.5e-03
Astrocytoma, Pilocytic -1.500 3.1e-05
atypical teratoid / rhabdoid tumor -1.600 1.7e-04
ependymoma -1.900 6.3e-03
glioblastoma -1.300 1.3e-05
group 3 medulloblastoma -2.700 5.0e-03
intraductal papillary-mucinous neoplasm ... -1.100 5.4e-04
medulloblastoma, large-cell -1.700 2.4e-03
oligodendroglioma -1.200 4.4e-02
Pick disease -1.400 2.0e-04

 GO Process (1)

Gene RIF (16)

AA Sequence

MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQ      1 - 70
KPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGT     71 - 140
WGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDP    141 - 210
VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLS    211 - 280
ASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL    281 - 350
SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD    351 - 420
GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCA    421 - 490
PIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS    491 - 560
HQSPE                                                                     561 - 565
//

Text Mined References (29)

PMID Year Title