Property Summary

NCBI Gene PubMed Count 23
Grant Count 7
R01 Count 5
Funding $825,065.57
PubMed Score 63.44
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
588619 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of Striatal-Enriched Phosphatase
588621 screening 889 / 0 / 358632 uHTS identification of small molecule inhibitors of Striatal-Enriched Phosphatase via a fluorescence intensity assay
602372 confirmatory 80 / 0 / 86 Dose response confirmation of uHTS small molecule inhibitors of Striatal-Enriched Phosphatase via a fluorescence intensity assay
623866 screening 166 / 0 / 358 Single concentration confirmation molecule inhibitors of Striatal-Enriched Phosphatase via a fluorescence intensity assay
624207 confirmatory 23 / 0 / 143 Dose response orthogonal assay of uHTS small molecule inhibitors of Striatal-Enriched Phosphatase via a colorimetric intensity assay.

Gene RIF (14)

PMID Text
26872063 A rare missense variant in the PTPN5 gene (rs56234898; minor allele frequency 1.5%) was significantly associated with decreased severity of Post-Burn Hypertrophic Scarring(P = 1.3x10-6).
25786133 STEP levels are unchanged in pre-frontal cortex and associative striatum in post-mortem human brain samples from subjects with schizophrenia, bipolar disorder and major depressive disorder
25218562 Article focuses on the most recent findings on STEP, discuss how STEP expression and activity are maintained during normal cognitive function, and how disruptions in STEP activity contribute to a number of illnesses. [Review]
24588402 Decreased STEP protein activation in corpus striatum contributes to early enhanced apoptotic signaling in YAC model transgenic mice.
22885232 This experiments demonstrated that deletion of STEP can enhance experience-induced neuroplasticity and memory formation
22649233 This study identified a novel role for PTPN5 in mediating the development of stress-related cognitive and morphological changes.
22555153 The results imply a model in which PTPN5 may play a role in normal cognitive functioning and contribute to aspects of the neuropathology of schizophrenia.
21883219 STEP(61kDa) is required for Abeta transgene-mediated internalization of GluA1/GluA2 glutamate receptors in a transgenic mousemodel.
20699650 STEP contributes to aspects of the pathophysiology in Alzheimer's disease; loss of GluN1/GluN2B subunits from neuronal membranes and Abeta-mediated NMDAR internalization are discussed
20427654 findings show that STEP(61) levels are progressively increased in the prefrontal cortex of Alzheimer disease brains
More...

AA Sequence

MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQ      1 - 70
KPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGT     71 - 140
WGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDP    141 - 210
VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLS    211 - 280
ASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL    281 - 350
SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD    351 - 420
GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCA    421 - 490
PIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS    491 - 560
HQSPE                                                                     561 - 565
//

Text Mined References (27)

PMID Year Title
26872063 2016 Missense Variant in MAPK Inactivator PTPN5 Is Associated with Decreased Severity of Post-Burn Hypertrophic Scarring.
25786133 2015 STEP levels are unchanged in pre-frontal cortex and associative striatum in post-mortem human brain samples from subjects with schizophrenia, bipolar disorder and major depressive disorder.
25416956 2014 A proteome-scale map of the human interactome network.
25218562 2014 Disruption of striatal-enriched protein tyrosine phosphatase (STEP) function in neuropsychiatric disorders.
24588402 2014 Alterations in STriatal-Enriched protein tyrosine Phosphatase expression, activation, and downstream signaling in early and late stages of the YAC128 Huntington's disease mouse model.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22885232 2012 The tyrosine phosphatase STEP constrains amygdala-dependent memory formation and neuroplasticity.
22649233 2012 A critical role for protein tyrosine phosphatase nonreceptor type 5 in determining individual susceptibility to develop stress-related cognitive and morphological changes.
22555153 2012 Involvement of PTPN5, the gene encoding the striatal-enriched protein tyrosine phosphatase, in schizophrenia and cognition.
21883219 2011 Reduced levels of the tyrosine phosphatase STEP block ? amyloid-mediated GluA1/GluA2 receptor internalization.
More...