Property Summary

NCBI Gene PubMed Count 38
PubMed Score 116.82
PubTator Score 58.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Holoprosencephaly 56 4.699 2.3
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.1

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.061 2.6e-03
adrenocortical carcinoma -1.237 1.8e-02
adult high grade glioma 1.200 1.6e-02
astrocytoma 1.400 3.2e-09
Atopic dermatitis -1.600 8.1e-05
atypical teratoid / rhabdoid tumor 2.500 5.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.328 9.4e-03
Breast cancer -2.800 2.2e-11
breast carcinoma -1.700 2.6e-06
cystic fibrosis -1.100 2.7e-04
Duchenne muscular dystrophy 1.412 6.4e-06
ductal carcinoma in situ -1.300 1.9e-03
ependymoma 1.300 7.6e-05
glioblastoma 2.100 1.7e-05
intraductal papillary-mucinous adenoma (... -4.400 2.9e-06
intraductal papillary-mucinous carcinoma... -5.000 2.4e-07
intraductal papillary-mucinous neoplasm ... -4.000 5.5e-03
invasive ductal carcinoma -1.300 1.5e-02
lung adenocarcinoma -1.300 2.8e-06
lung cancer -1.400 2.1e-03
malignant mesothelioma -2.000 1.4e-07
medulloblastoma 1.500 6.9e-04
medulloblastoma, large-cell 1.300 2.0e-03
non primary Sjogren syndrome sicca 1.400 1.9e-02
oligodendroglioma 1.300 1.4e-09
osteosarcoma 1.145 1.7e-02
ovarian cancer -4.200 5.2e-11
pituitary cancer -4.300 6.8e-09
ulcerative colitis 2.900 7.2e-03

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPECSYAYNQYAE      1 - 70
ACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTK     71 - 140
RAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDM    141 - 210
LAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGG    211 - 280
EQPLDDDDGVPHPPRPGSGAAASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF         281 - 345
//

Text Mined References (39)

PMID Year Title