Property Summary

NCBI Gene PubMed Count 33
Grant Count 50
R01 Count 33
Funding $7,857,717.26
PubMed Score 110.04
PubTator Score 58.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
25888394 solutions structure and biophysical characterization of the multifaceted signalling effector protein growth arrest specific-1
25429664 This review summarizes the structure of Gas1 and molecular mechanism of action during embryonic development and cellular functions.
23254899 GAS1 is a novel endogenous inhibitor of glomerular mesangial cell proliferation.
22846196 Growth arrest-specific gene 1 is downregulated and inhibits tumor growth in gastric cancer.
22311470 GAS1 induced the activity of caspase-3 and resulting in apoptosis of the cells.
21971401 Interference of endoplasmic reticulum to Golgi transport increased immature amyloid beta protein precursor accumulation upon Gas1 expression in lipid raft fractions.
21842183 we demonstrate that sequence variants in GAS1 can impair its physical interaction with SHH, suggesting a decrease in the SHH downstream signaling cascade as a pathogenic mechanism of disease.
21357679 Gas1 is a novel APP-interacting protein involved in the control of APP maturation and processing.
21111449 Growth arrest-specific gene 1 contributes to predicting metastasis or recurrence in stage II and III colorectal cancer.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPECSYAYNQYAE      1 - 70
ACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTK     71 - 140
RAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDM    141 - 210
LAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGG    211 - 280
EQPLDDDDGVPHPPRPGSGAAASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF         281 - 345
//

Publication (34)

PMID Year Title
25888394 2015 Solution structure and biophysical characterization of the multifaceted signalling effector protein growth arrest specific-1.
25429664 2014 Gas1 is a pleiotropic regulator of cellular functions: from embryonic development to molecular actions in cancer gene therapy.
23254899 2013 Growth arrest-specific protein 1 is a novel endogenous inhibitor of glomerular cell activation and proliferation.
22846196 2012 Growth arrest-specific gene 1 is downregulated and inhibits tumor growth in gastric cancer.
22311470 2012 GAS1 induces cell death through an intrinsic apoptotic pathway.
21971401 2012 Gas1 interferes with A?PP trafficking by facilitating the accumulation of immature A?PP in endoplasmic reticulum-associated raft subdomains.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
21842183 2012 Missense substitutions in the GAS1 protein present in holoprosencephaly patients reduce the affinity for its ligand, SHH.
21357679 2011 Growth arrest-specific 1 binds to and controls the maturation and processing of the amyloid-beta precursor protein.
21111449 2011 Down-regulated GAS1 expression correlates with recurrence in stage II and III colorectal cancer.
More...