Property Summary

NCBI Gene PubMed Count 33
PubMed Score 110.04
PubTator Score 58.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 2.21305277035825E-11
ovarian cancer 8492 5.23009407984132E-11
oligodendroglioma 2849 1.4262019917843E-9
astrocytoma 1493 3.20106109073281E-9
pituitary cancer 1972 6.7916351912565E-9
atypical teratoid/rhabdoid tumor 1095 1.0037020036052E-8
malignant mesothelioma 3163 1.36388192253326E-7
sonic hedgehog group medulloblastoma 1482 1.89103929689187E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.36072025247221E-7
lung cancer 4473 2.22340857730725E-6
breast carcinoma 1614 2.62497517603687E-6
lung adenocarcinoma 2714 2.77758447232705E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.86450510416897E-6
Duchenne muscular dystrophy 602 6.43857136958163E-6
posterior fossa group B ependymoma 1530 9.61653272942886E-6
pediatric high grade glioma 2712 1.15990652321022E-5
Atopic dermatitis 944 8.08015039814008E-5
cystic fibrosis 1670 2.66796381913372E-4
invasive ductal carcinoma 2950 3.85133639731339E-4
glioblastoma 5572 8.45387317573775E-4
medulloblastoma, large-cell 6234 0.00203300628438106
acute quadriplegic myopathy 1157 0.00262627535417821
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00546849963036984
ulcerative colitis 2087 0.00721062657166708
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00935352184765185
osteosarcoma 7933 0.00974025685396129
ductal carcinoma in situ 1745 0.0144288170414506
adrenocortical carcinoma 1427 0.0180039927868157
non primary Sjogren syndrome sicca 840 0.0188504800150952
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0

Expression

Synonym

Accession P54826 B9EGM4 Q6B086 GAS-1
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (19)

PMID Text
25888394 solutions structure and biophysical characterization of the multifaceted signalling effector protein growth arrest specific-1
25429664 This review summarizes the structure of Gas1 and molecular mechanism of action during embryonic development and cellular functions.
23254899 GAS1 is a novel endogenous inhibitor of glomerular mesangial cell proliferation.
22846196 Growth arrest-specific gene 1 is downregulated and inhibits tumor growth in gastric cancer.
22311470 GAS1 induced the activity of caspase-3 and resulting in apoptosis of the cells.
21971401 Interference of endoplasmic reticulum to Golgi transport increased immature amyloid beta protein precursor accumulation upon Gas1 expression in lipid raft fractions.
21842183 we demonstrate that sequence variants in GAS1 can impair its physical interaction with SHH, suggesting a decrease in the SHH downstream signaling cascade as a pathogenic mechanism of disease.
21357679 Gas1 is a novel APP-interacting protein involved in the control of APP maturation and processing.
21111449 Growth arrest-specific gene 1 contributes to predicting metastasis or recurrence in stage II and III colorectal cancer.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPECSYAYNQYAE      1 - 70
ACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTK     71 - 140
RAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDM    141 - 210
LAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGG    211 - 280
EQPLDDDDGVPHPPRPGSGAAASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF         281 - 345
//

Text Mined References (34)

PMID Year Title
25888394 2015 Solution structure and biophysical characterization of the multifaceted signalling effector protein growth arrest specific-1.
25429664 2014 Gas1 is a pleiotropic regulator of cellular functions: from embryonic development to molecular actions in cancer gene therapy.
23254899 2013 Growth arrest-specific protein 1 is a novel endogenous inhibitor of glomerular cell activation and proliferation.
22846196 2012 Growth arrest-specific gene 1 is downregulated and inhibits tumor growth in gastric cancer.
22311470 2012 GAS1 induces cell death through an intrinsic apoptotic pathway.
21971401 2012 Gas1 interferes with A?PP trafficking by facilitating the accumulation of immature A?PP in endoplasmic reticulum-associated raft subdomains.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
21842183 2012 Missense substitutions in the GAS1 protein present in holoprosencephaly patients reduce the affinity for its ligand, SHH.
21357679 2011 Growth arrest-specific 1 binds to and controls the maturation and processing of the amyloid-beta precursor protein.
21111449 2011 Down-regulated GAS1 expression correlates with recurrence in stage II and III colorectal cancer.
More...