Property Summary

NCBI Gene PubMed Count 32
Grant Count 75
R01 Count 45
Funding $7,379,593.13
PubMed Score 32.29
PubTator Score 42.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P54821 B5BUM7 O60807
Symbols PMX1
PRX1
AGOTC
PHOX1
PRX-1

Gene

 GO Component (2)

Gene RIF (17)

PMID Text
26773005 the switch from Prrx1b to Prrx1a governs EMT plasticity in both mouse models of PDAC and human PDAC
25522823 Our results indicate that activation of Notch signaling by PRRX1 is associated with the promotion of glioblastoma cell invasion.
25428393 These findings demonstrate that PRRX1 promotes epithelial-mesenchymal transition in gastric cancer cells
25404478 Decreased Expression of PRRX1 was Associated with Hepatocellular Carcinoma.
24946010 We conclude that miR-146b-5p has a role in cell proliferation and invasion, and that PRRX1 plays an important role in papillary thyroid carcinoma epithelial-mesenchymal transition and disease progression.
24705396 Overexpression of PRRX1 in stably overexpressed-miR-124 cell lines could rescue the effects of radiosensitivity enhancement brought by miR-124.
24239840 In the rare variant joint analysis, damaging variants within the PRRX1 region showed significant association with AF.
23807160 PRRX1 is an indicator of metastasis and poor prognosis in colorectal cancer cases.
23201163 The homeobox factor Prrx1 is an EMT inducer conferring migratory and invasive properties.
23201163 We show that the homeobox factor Prrx1 is an EMT inducer conferring migratory and invasive properties. The loss of Prrx1 is required for cancer cells to metastasize in vivo, which revert to the epithelial phenotype concomitant with the acquisition of stem cell properties.
More...

AA Sequence

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL      1 - 70
TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV     71 - 140
WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA    141 - 210
NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN                                       211 - 245
//

Publication (34)

PMID Year Title
26773005 2016 Prrx1 isoform switching regulates pancreatic cancer invasion and metastatic colonization.
25522823 2015 Paired related homeobox 1 is associated with the invasive properties of glioblastoma cells.
25428393 2015 PRRX1 promotes epithelial-mesenchymal transition through the Wnt/?-catenin pathway in gastric cancer.
25404478 2015 Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.
24946010 2014 The roles of the epithelial-mesenchymal transition marker PRRX1 and miR-146b-5p in papillary thyroid carcinoma progression.
24705396 2014 MiR-124 Radiosensitizes human colorectal cancer cells by targeting PRRX1.
24239840 2014 Targeted sequencing in candidate genes for atrial fibrillation: the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Targeted Sequencing Study.
23807160 2013 Paired related homoeobox 1, a new EMT inducer, is involved in metastasis and poor prognosis in colorectal cancer.
23201163 2012 Metastatic colonization requires the repression of the epithelial-mesenchymal transition inducer Prrx1.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
More...