Property Summary

NCBI Gene PubMed Count 35
PubMed Score 38.78
PubTator Score 42.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 1.7
Heart conduction disease 83 0.0 3.0
Disease Target Count Z-score Confidence
agnathia-otocephaly complex 8 6.275 3.1

Expression

  Differential Expression (29)

 GO Component (2)

Gene RIF (20)

AA Sequence

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL      1 - 70
TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV     71 - 140
WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA    141 - 210
NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN                                       211 - 245
//

Text Mined References (37)

PMID Year Title