Property Summary

NCBI Gene PubMed Count 32
PubMed Score 32.29
PubTator Score 42.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
astrocytoma 1493 9.55026478431452E-28
oligodendroglioma 2849 5.29437557169756E-19
juvenile dermatomyositis 1189 5.7311722063442E-14
pilocytic astrocytoma 3086 6.93874173379646E-10
glioblastoma 5572 5.62593905842691E-8
lung carcinoma 2844 8.8592998648753E-8
ovarian cancer 8492 8.92846877849844E-8
Duchenne muscular dystrophy 602 6.63543534529056E-7
acute quadriplegic myopathy 1157 9.59594374716337E-6
adult high grade glioma 2148 4.0916744644419E-5
interstitial cystitis 2299 2.89715014786584E-4
primary pancreatic ductal adenocarcinoma 1271 5.0701550315292E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.86245567506464E-4
medulloblastoma, large-cell 6234 6.07240068520678E-4
pancreatic cancer 2300 6.34268811544079E-4
ulcerative colitis 2087 7.82029029441792E-4
nasopharyngeal carcinoma 1056 9.99546212307632E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00133447058625214
osteosarcoma 7933 0.00165418794251239
psoriasis 6685 0.00228649520374719
atypical teratoid / rhabdoid tumor 4369 0.00272410139760286
primary Sjogren syndrome 789 0.00284971184075337
gastric carcinoma 832 0.0058320794563497
ependymoma 2514 0.00669556513940398
hereditary spastic paraplegia 313 0.00826342138889137
invasive ductal carcinoma 2950 0.010425376437454
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0132517429828579
subependymal giant cell astrocytoma 2287 0.033930510578586
Gaucher disease type 1 171 0.0349078773478127
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 1.0
Heart conduction disease 65 0.0 2.0
Disease Target Count
Dysgnathia complex 2
Disease Target Count
Agnathia-otocephaly complex 8

Expression

Synonym

Accession P54821 B5BUM7 O60807
Symbols PMX1
PRX1
AGOTC
PHOX1
PRX-1

Gene

  Ortholog (9)

 GO Component (2)

Pathway (1)

Gene RIF (17)

PMID Text
26773005 the switch from Prrx1b to Prrx1a governs EMT plasticity in both mouse models of PDAC and human PDAC
25522823 Our results indicate that activation of Notch signaling by PRRX1 is associated with the promotion of glioblastoma cell invasion.
25428393 These findings demonstrate that PRRX1 promotes epithelial-mesenchymal transition in gastric cancer cells
25404478 Decreased Expression of PRRX1 was Associated with Hepatocellular Carcinoma.
24946010 We conclude that miR-146b-5p has a role in cell proliferation and invasion, and that PRRX1 plays an important role in papillary thyroid carcinoma epithelial-mesenchymal transition and disease progression.
24705396 Overexpression of PRRX1 in stably overexpressed-miR-124 cell lines could rescue the effects of radiosensitivity enhancement brought by miR-124.
24239840 In the rare variant joint analysis, damaging variants within the PRRX1 region showed significant association with AF.
23807160 PRRX1 is an indicator of metastasis and poor prognosis in colorectal cancer cases.
23201163 The homeobox factor Prrx1 is an EMT inducer conferring migratory and invasive properties.
23201163 We show that the homeobox factor Prrx1 is an EMT inducer conferring migratory and invasive properties. The loss of Prrx1 is required for cancer cells to metastasize in vivo, which revert to the epithelial phenotype concomitant with the acquisition of stem cell properties.
More...

AA Sequence

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL      1 - 70
TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV     71 - 140
WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA    141 - 210
NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN                                       211 - 245
//

Text Mined References (34)

PMID Year Title
26773005 2016 Prrx1 isoform switching regulates pancreatic cancer invasion and metastatic colonization.
25522823 2015 Paired related homeobox 1 is associated with the invasive properties of glioblastoma cells.
25428393 2015 PRRX1 promotes epithelial-mesenchymal transition through the Wnt/?-catenin pathway in gastric cancer.
25404478 2015 Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.
24946010 2014 The roles of the epithelial-mesenchymal transition marker PRRX1 and miR-146b-5p in papillary thyroid carcinoma progression.
24705396 2014 MiR-124 Radiosensitizes human colorectal cancer cells by targeting PRRX1.
24239840 2014 Targeted sequencing in candidate genes for atrial fibrillation: the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Targeted Sequencing Study.
23807160 2013 Paired related homoeobox 1, a new EMT inducer, is involved in metastasis and poor prognosis in colorectal cancer.
23201163 2012 Metastatic colonization requires the repression of the epithelial-mesenchymal transition inducer Prrx1.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
More...