Property Summary

NCBI Gene PubMed Count 22
Grant Count 18
R01 Count 3
Funding $3,396,413.54
PubMed Score 90.57
PubTator Score 52.25

Knowledge Summary

Patent (5,806)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.400 0.001
psoriasis -1.300 0.001
glioblastoma 1.700 0.003
osteosarcoma 1.848 0.000
posterior fossa group A ependymoma 1.300 0.000
astrocytoma 1.500 0.009
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.272 0.006
lung cancer -1.500 0.001
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma 1.200 0.002
pilocytic astrocytoma 1.600 0.000
lung adenocarcinoma 1.200 0.000
Breast cancer 1.100 0.000

Gene RIF (9)

PMID Text
26270350 AK2 deficiency compromises the mitochondrial energy metabolism required for differentiation of human neutrophil and lymphoid lineages.
24587121 AK2 is indispensable for neutrophil differentiation, indicating a possible causative link between AK2 deficiency and neutropenia in reticular dysgenesis.
24548998 results suggest that AK2 is an associated activator of DUSP26 and suppresses cell proliferation by FADD dephosphorylation, postulating AK2 as a negative regulator of tumour growth.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of adenylate kinase 2 (AK2) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
19043417 The gene encoding the mitochondrial energy metabolism enzyme adenylate kinase 2 (AK2) is mutated in individuals with reticular dysgenesis.
19043416 Biallelic mutations in AK2 (adenylate kinase 2) in seven individuals affected with reticular dysgenesis and sensorineural deafness, were identified.
18404568 The alpha-borano or alpha-H on PMEA and PMPA were detrimental to the activity of recombinant human AMP kinases 2
17952061 These results suggest that, acting in concert with FADD and caspase-10, AK2 mediates a novel intrinsic apoptotic pathway that may be involved in tumorigenesis.

AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA      1 - 70
GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT     71 - 140
GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI    141 - 210
DASQTPDVVFASILAAFSKATCKDLVMFI                                             211 - 239
//

Publication (29)

PMID Year Title
26270350 2015 AK2 deficiency compromises the mitochondrial energy metabolism required for differentiation of human neutrophil and lymphoid lineages.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24587121 2014 Differential expression of adenine nucleotide converting enzymes in mitochondrial intermembrane space: a potential role of adenylate kinase isozyme 2 in neutrophil differentiation.
24548998 2014 The DUSP26 phosphatase activator adenylate kinase 2 regulates FADD phosphorylation and cell growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...