Property Summary

NCBI Gene PubMed Count 55
PubMed Score 363.21
PubTator Score 222.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Leukodystrophy, Globoid Cell 1 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.1
Heart disease 306 0.0 3.0
Rheumatoid arthritis 1191 0.0 0.9
Disease Target Count Z-score Confidence
Krabbe disease 12 8.236 4.0
Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 1.344 2.7e-02
Alzheimer's disease -1.100 4.9e-02
atypical teratoid / rhabdoid tumor 2.000 1.4e-05
Barrett's esophagus 1.500 2.5e-02
dermatomyositis 1.100 3.1e-03
ependymoma 1.800 9.8e-03
esophageal adenocarcinoma 2.000 1.8e-02
glioblastoma 1.700 5.9e-06
group 4 medulloblastoma 1.100 8.7e-03
lung cancer -1.300 1.9e-02
malignant mesothelioma -6.700 3.0e-10
medulloblastoma, large-cell -1.900 3.0e-05
oligodendroglioma 1.200 8.6e-03
ovarian cancer -3.200 1.6e-12
pediatric high grade glioma 1.100 1.2e-03
Pick disease -1.300 7.2e-05
progressive supranuclear palsy -1.400 8.6e-03
Waldenstrons macroglobulinemia 1.484 1.3e-02

 OMIM Phenotype (1)

Gene RIF (27)

AA Sequence

MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRL      1 - 70
LVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKR     71 - 140
NPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILR    141 - 210
KMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLN    211 - 280
SDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQF    281 - 350
TQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEI    351 - 420
PELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTY    421 - 490
KDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNL    491 - 560
TIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWY    561 - 630
TLTLTIKGHFTSGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR                   631 - 685
//

Text Mined References (54)

PMID Year Title