Property Summary

NCBI Gene PubMed Count 37
PubMed Score 159.92
PubTator Score 305.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Kluver-Bucy syndrome 6 3.681 1.8
Fucosidosis 10 3.379 1.7
Disease Target Count
Sanfilippo syndrome type B 1

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.593 1.2e-02

Gene RIF (14)

AA Sequence

MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGG      1 - 70
GAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSY     71 - 140
SFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTW    141 - 210
DGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFL    211 - 280
LAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQ    281 - 350
GWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGAL    351 - 420
EAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDA    421 - 490
GAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDL    491 - 560
LDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAV    561 - 630
SEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKN    631 - 700
VFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSW                               701 - 743
//

Text Mined References (46)

PMID Year Title