Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.74
PubTator Score 97.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.9e-10
osteosarcoma 7950 6.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Chondrodysplasia punctata 41 5.402 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.252 6.2e-06
psoriasis 2.200 3.9e-10

AA Sequence

MRPRRPLVFMSLVCALLNTCQAHRVHDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDRLAREGVRLTQ      1 - 70
HISAASLCSPSRSAFLTGRYPIRSGMVSSGNRRVIQNLAVPAGLPLNETTLAALLKKQGYSTGLIGKWHQ     71 - 140
GLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRNTELAFESQLWLCVQLVAIAILTLTFGKLSG    141 - 210
WVSVPWLLIFSMILFIFLLGYAWFSSHTSPLYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLERHSK    211 - 280
ETFLLFFSFLHVHTPLPTTDDFTGTSKHGLYGDNVEEMDSMVGKILDAIDDFGLRNNTLVYFTSDHGGHL    281 - 350
EARRGHAQLGGWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQ    351 - 420
DRVIDGRDLMPLLQGNVRHSEHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPPASGGCYVTSL    421 - 490
CRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKEHQETIVPVTYQLSELNQGRT    491 - 560
WLKPCCGVFPFCLCDKEEEVSQPRGPNEKR                                            561 - 590
//

Text Mined References (12)

PMID Year Title