Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.97
PubTator Score 97.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 6.06924957508428E-240
osteosarcoma 7933 6.22166364624339E-6
Disease Target Count Z-score Confidence
Chondrodysplasia punctata 41 5.374 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 3.600 0.000
osteosarcoma 1.252 0.000

Synonym

Accession P54793 Q8TCC5 ASF
Symbols ASF

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MRPRRPLVFMSLVCALLNTCQAHRVHDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDRLAREGVRLTQ      1 - 70
HISAASLCSPSRSAFLTGRYPIRSGMVSSGNRRVIQNLAVPAGLPLNETTLAALLKKQGYSTGLIGKWHQ     71 - 140
GLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRNTELAFESQLWLCVQLVAIAILTLTFGKLSG    141 - 210
WVSVPWLLIFSMILFIFLLGYAWFSSHTSPLYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLERHSK    211 - 280
ETFLLFFSFLHVHTPLPTTDDFTGTSKHGLYGDNVEEMDSMVGKILDAIDDFGLRNNTLVYFTSDHGGHL    281 - 350
EARRGHAQLGGWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQ    351 - 420
DRVIDGRDLMPLLQGNVRHSEHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPPASGGCYVTSL    421 - 490
CRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKEHQETIVPVTYQLSELNQGRT    491 - 560
WLKPCCGVFPFCLCDKEEEVSQPRGPNEKR                                            561 - 590
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9685421 1998 A serine/arginine-rich domain in the human U1 70k protein is necessary and sufficient for ASF/SF2 binding.
9229115 1997 The sulfatase gene family.
More...