Property Summary

NCBI Gene PubMed Count 7
PubMed Score 188.35
PubTator Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Robinow syndrome 11 3.73 1.9
Disease Target Count Z-score Confidence
Cancer 2499 3.729 1.9

Synonym

Accession P54792
Symbols DSH
DVL
DVL1
DVL4
DVL-22
DVL1L1

Gene

PANTHER Protein Class (1)

Gene RIF (3)

AA Sequence

MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL      1 - 70
PCFNGRVVSWLVLVEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRSPSFQPDVASSRDGMDNETGTESM     71 - 140
VSHRRDRARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDDSTSRLSSSTEQS    141 - 210
TSSRLIRKHKRRRRKQRLRQADRASSFSSMTDSTMSLNIITVTLNMERHHFLGICIVGQSNDRGDGGIYI    211 - 280
GSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP    281 - 350
RPDPVRPIDPAAWLSHTAALTGALPRPQLEEAPLTVESDMNTVVRVMQLPDSGLEIRDRMWLKITIANAV    351 - 420
IGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSG    421 - 490
TSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRNTLRP    491 - 560
PACEKERRAAGSGDSDSESDHTAPSGVGSSWRERPADQLSRGSSPRSQASSYAPGLPPPHPTTKAYTVVG    561 - 630
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM                                  631 - 670
//

Text Mined References (7)

PMID Year Title