Property Summary

NCBI Gene PubMed Count 7
PubMed Score 219.75
PubTator Score 0.95

Knowledge Summary


No data available


Accession P54792
Symbols DSH


PANTHER Protein Class (1)

Gene RIF (3)

20639201 A SDC4 deletion construct that interacts inefficiently with Dsh is resistant to Wnt5a-induced degradation.
19643732 Studies identify that CVAK104 as a novel binding partner of Dishevelled (Dvl) and that CVAK104 also interacts with Fzd5.
16604061 These data suggest a relationship between the Wnt-beta-catenin pathway and redox signalling through redox-sensitive association of NRX with Dvl.

AA Sequence

GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM                                  631 - 670

Text Mined References (7)

PMID Year Title
20639201 2010 Non-canonical Wnt signaling induces ubiquitination and degradation of Syndecan4.
19643732 2009 A coated vesicle-associated kinase of 104 kDa (CVAK104) induces lysosomal degradation of frizzled 5 (Fzd5).
16604061 2006 The thioredoxin-related redox-regulating protein nucleoredoxin inhibits Wnt-beta-catenin signalling through dishevelled.
10591208 1999 The DNA sequence of human chromosome 22.
9192851 1997 Human dishevelled genes constitute a DHR-containing multigene family.
8817329 1996 cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene.
8644734 1996 Human homologue sequences to the Drosophila dishevelled segment-polarity gene are deleted in the DiGeorge syndrome.