Property Summary

NCBI Gene PubMed Count 55
Grant Count 112
R01 Count 59
Funding $11,861,189.27
PubMed Score 234.48
PubTator Score 99.65

Knowledge Summary

Patent (39,568)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
astrocytic glioma -1.700 0.006
ependymoma -2.300 0.011
oligodendroglioma -2.700 0.028
uncontrolled asthma 1.100 0.017
glioblastoma -2.000 0.000
osteosarcoma 1.331 0.048
medulloblastoma -3.800 0.000
cystic fibrosis 1.419 0.000
atypical teratoid / rhabdoid tumor -1.900 0.032
medulloblastoma, large-cell -2.300 0.007
tuberculosis -2.800 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.040
intraductal papillary-mucinous carcinoma... 2.200 0.021
intraductal papillary-mucinous neoplasm ... 2.200 0.024
lung cancer 1.200 0.005
active Crohn's disease 1.427 0.007
Parkinson's disease -1.200 0.012
pancreatic cancer 1.300 0.005
pediatric high grade glioma -1.300 0.020
pilocytic astrocytoma -3.200 0.000
lung carcinoma 1.600 0.000
Breast cancer -1.200 0.011
invasive ductal carcinoma -1.200 0.003

Synonym

Accession P54764 A8K2P1 B2R601 B7Z6Q8 Q2M380
Symbols SEK
HEK8
TYRO1

Gene

PDB

2LW8   2WO1   2WO2   2WO3   3CKH   3GXU   4BK4   4BK5   4BKA   4BKF   4M4P   4M4R   4W4Z   4W50   5JR2  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
26376612 EPHA4 is overexpressed but not functionally active in Sezary syndrome.
24217950 EphA4 induced accumulation of amyloid precursor protein through a Lyn-mediated pathway.
23959867 Data indicate that ephrin-A5 binding directly facilitates the formation of Eph/ephrin clusters by inducing conformational changes in the ligand-binding domain (LBD) of EphA4.
23429488 High Eph A4 expression is associated with choriocarcinoma invasion.
22922411 Epha4 modulates the vulnerability of motor neurons to axonal degeneration and may represent a new target for therapeutic intervention in ALS.
22807579 EphA4 gene expression is associated with an improved outcome in patients with resected lung adenocarcinoma, possibly by affecting cancer cell migration and invasion.
22318127 The present study demonstrates that EphA4 is expressed on neurons in multiple regions of the intact human brain and is markedly upregulated on activated astrocytes after TBI
22273509 The platelet P2Y12 receptor contributes to granule secretion through Ephrin A4 receptor.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21873938 The present data suggest that Eph-A2, but not Eph-A4, overexpression may be associated with the malignant transformation of thyroid neoplasia.
More...

AA Sequence

MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTY      1 - 70
QVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIREN     71 - 140
QFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRN    141 - 210
LAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGY    211 - 280
YKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSS    281 - 350
PQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS    351 - 420
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRI    421 - 490
VRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLV    491 - 560
VILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVG    561 - 630
EFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITE    631 - 700
YMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRV    701 - 770
LEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG    771 - 840
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEF    841 - 910
SAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMH    911 - 980
GRMVPV                                                                    981 - 986
//

Text Mined References (63)

PMID Year Title
26376612 2015 EPHA4 is overexpressed but not functionally active in Sézary syndrome.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24217950 2014 Ligand-dependent activation of EphA4 signaling regulates the proteolysis of amyloid precursor protein through a Lyn-mediated pathway.
23959867 2013 Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23429488 2013 Eph-ephrin A system regulates human choriocarcinoma-derived JEG-3 cell invasion.
22922411 2012 EPHA4 is a disease modifier of amyotrophic lateral sclerosis in animal models and in humans.
22807579 2012 Global evaluation of Eph receptors and ephrins in lung adenocarcinomas identifies EphA4 as an inhibitor of cell migration and invasion.
22318127 2012 Expression and activation of EphA4 in the human brain after traumatic injury.
22273509 2012 The platelet P2Y12 receptor contributes to granule secretion through Ephrin A4 receptor.
More...