Property Summary

NCBI Gene PubMed Count 59
Grant Count 65
R01 Count 40
Funding $5,044,793.48
PubMed Score 48.22
PubTator Score 36.69

Knowledge Summary

Patent (156,871)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.600 0.002
posterior fossa group A ependymoma -1.400 0.000
oligodendroglioma 1.700 0.002
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -4.000 0.000
pancreatic ductal adenocarcinoma liver m... -1.828 0.000
non-small cell lung cancer 1.412 0.000
psoriasis -1.100 0.000
breast carcinoma -1.300 0.000
spina bifida -1.268 0.017
Breast cancer -4.100 0.000
pituitary cancer 3.100 0.000

Synonym

Accession P54762 A8K593 B3KTB2 B5A969 O43569 O95142 O95143 Q0VG87
Symbols ELK
NET
Hek6
EPHT2

Gene

PDB

2DJS   2EAO   3ZFX  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (27)

PMID Text
25944917 The tumor-suppressor function of EphB1 is clinically relevant across many malignancies, suggesting that EphB1 is an important regulator of common cancer cell transforming pathways.
25879388 In medulloblastoma cell lines, EphB1 downregulation or knockdown reduced cell growth, viability, cell-cycle regulator expression, and migration, but increased radiosensitivity and the percentage of cells in G1 phase of the cell cycle.
25120806 Our results indicate that EphB1 may be involved in carcinogenesis of renal cell carcinoma
24716914 The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies.
24677421 The study presents the first structure of the EphB1 tyrosine kinase domain determined by X-ray crystallography to 2.5A.
24606480 EphB1 and Ephrin-B could be regarded as independent good prognostic factors and important biological markers for Squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
24427352 Our data indicate that loss of EphB1 protein is associated with metastasis and poorer survival in patients with serous ovarian cancer
24121831 Low EphB1 expression is associated with glioma.
23118026 EphB1 stimulation triggered approximately 50% serine-threonine PTEN dephosphorylation and PTEN-Cbl complex disruption, a process requiring PTEN protein phosphatase activity.
21804545 Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion.
21763378 EPHB1 polymorphisms may be associated with susceptibility to hepatocellular carcinoma in the Korean population.
21124932 Data shew that the identification of three novel candidates as EPH receptor genes might indicate a link between perturbed compartmentalization of early neoplastic lesions and breast cancer risk and progression.
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21041834 No association is found for EPH receptor B1 and susceptibility to schizophrenia.
21041834 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19736353 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18931529 EphB1 may have roles in the pathogenesis and development of colorectal cancer.
18649358 Observational study of gene-disease association. (HuGE Navigator)
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18424888 Loss of expression of EphB1 protein in gastric carcinoma is associated with invasion and metastasis
18057206 Transgenic EphB1 and ephrin-B3 cooperatively regulate the proliferation and migration of neural progenitors in the hippocampus.
18034775 The ubiquitin ligase Cbl induces the ubiquitination and lysosomal degradation of activated EphB1, a process requiring EphB1 and Src kinase activity.
15722342 analysis of EphB1, EphB2, and EphB4-binding peptides interaction with antagonists with ephrin-like affinity
14576067 Eph/ephrin signaling enhances the ability of platelet agonists to cause aggregation provided that those agonists can increase cytosolic Ca(++) and this is accomplished in part by activating Rap1
12084815 Human platelets express EphA4 and EphB1, and the ligand, ephrinB1. Forced clustering of EphA4 or ephrinB1 led to cytoskeletal reorganization, adhesion to fibrinogen, and alpha-granule secretion.
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNN      1 - 70
WLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTI     71 - 140
AADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETM    141 - 210
TGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQE    211 - 280
AEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGG    281 - 350
RDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP    351 - 420
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNT    421 - 490
ARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAIS    491 - 560
IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEF    561 - 630
GEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFM    631 - 700
ENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ    701 - 770
DDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD    771 - 840
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDF    841 - 910
TAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSP    911 - 980
TAMA                                                                      981 - 984
//

Text Mined References (62)

PMID Year Title
25944917 2015 EphB1 Suppression in Acute Myelogenous Leukemia: Regulating the DNA Damage Control System.
25879388 2015 Knockdown of EphB1 receptor decreases medulloblastoma cell growth and migration and increases cellular radiosensitization.
25120806 2014 Decreased expression of receptor tyrosine kinase of EphB1 protein in renal cell carcinomas.
24716914 2014 Increased expression of P2RY2, CD248 and EphB1 in gastric cancers from Chilean patients.
24677421 2014 Completing the structural family portrait of the human EphB tyrosine kinase domains.
24606480 2014 EphB1 and Ephrin-B, new potential biomarkers for squamous cell/adenosquamous carcinomas and adenocarcinomas of the gallbladder.
24427352 2014 Loss of expression of EphB1 protein in serous carcinoma of ovary associated with metastasis and poor survival.
24121831 2013 Ligand-dependent EphB1 signaling suppresses glioma invasion and correlates with patient survival.
23118026 2013 Phosphatase and tensin homolog regulates stability and activity of EphB1 receptor.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21804545 2011 Cleavage of E-cadherin by ADAM10 mediates epithelial cell sorting downstream of EphB signalling.
21763378 2011 Associations of EPHB1 polymorphisms with hepatocellular carcinoma in the Korean population.
21124932 2010 Exploring the link between germline and somatic genetic alterations in breast carcinogenesis.
21085126 2011 SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population.
21041834 2012 Resequencing and association analysis of the KALRN and EPHB1 genes and their contribution to schizophrenia susceptibility.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19736353 2009 A genomewide association study points to multiple loci that predict antidepressant drug treatment outcome in depression.
18931529 2008 EphB1 is underexpressed in poorly differentiated colorectal cancers.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18424888 2007 Loss of expression of EphB1 protein in gastric carcinoma associated with invasion and metastasis.
18057206 2007 EphB receptors regulate stem/progenitor cell proliferation, migration, and polarity during hippocampal neurogenesis.
18034775 2008 Ligand binding induces Cbl-dependent EphB1 receptor degradation through the lysosomal pathway.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15722342 2005 EphB receptor-binding peptides identified by phage display enable design of an antagonist with ephrin-like affinity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15107421 2004 EphB1-mediated cell migration requires the phosphorylation of paxillin at Tyr-31/Tyr-118.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576067 2004 Signaling by ephrinB1 and Eph kinases in platelets promotes Rap1 activation, platelet adhesion, and aggregation via effector pathways that do not require phosphorylation of ephrinB1.
12925710 2003 EphB1 recruits c-Src and p52Shc to activate MAPK/ERK and promote chemotaxis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223469 2002 EphB1 associates with Grb7 and regulates cell migration.
12118063 2002 Ephrin-B1 transduces signals to activate integrin-mediated migration, attachment and angiogenesis.
12084815 2002 Interactions between Eph kinases and ephrins provide a mechanism to support platelet aggregation once cell-to-cell contact has occurred.
11713248 2002 The kinase-null EphB6 receptor undergoes transphosphorylation in a complex with EphB1.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10669731 2000 Nck-interacting Ste20 kinase couples Eph receptors to c-Jun N-terminal kinase and integrin activation.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10066262 1999 Specification of distinct dopaminergic neural pathways: roles of the Eph family receptor EphB1 and ligand ephrin-B2.
9736245 1998 Origins and formation of microvasculature in the developing kidney.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9499402 1998 Eph receptors discriminate specific ligand oligomers to determine alternative signaling complexes, attachment, and assembly responses.
9430661 1998 Nck recruitment to Eph receptor, EphB1/ELK, couples ligand activation to c-Jun kinase.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
9245480 1997 LERK-7: a ligand of the Eph-related kinases is developmentally regulated in the brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8798570 1996 Ligand activation of ELK receptor tyrosine kinase promotes its association with Grb10 and Grb2 in vascular endothelial cells.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8666391 1995 cDNA cloning, molecular characterization, and chromosomal localization of NET(EPHT2), a human EPH-related receptor protein-tyrosine kinase gene preferentially expressed in brain.
8559144 1995 Isolation of LERK-5: a ligand of the eph-related receptor tyrosine kinases.
8070404 1994 Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors.
7973638 1994 Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.