Property Summary

Ligand Count 6
NCBI Gene PubMed Count 62
PubMed Score 51.97
PubTator Score 36.69

Knowledge Summary

Patent (156,871)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 5.3e-03
atypical teratoid / rhabdoid tumor -1.200 1.1e-02
Breast cancer -4.100 6.6e-27
breast carcinoma -1.300 4.7e-20
ependymoma 1.100 3.1e-02
medulloblastoma, large-cell -1.300 8.9e-03
non-small cell lung cancer 1.412 3.9e-07
oligodendroglioma 1.100 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.828 1.8e-04
pituitary cancer 1.900 1.5e-05
psoriasis -1.100 3.3e-06
spina bifida -1.268 1.7e-02

Gene RIF (30)

AA Sequence

MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNN      1 - 70
WLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTI     71 - 140
AADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETM    141 - 210
TGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQE    211 - 280
AEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGG    281 - 350
RDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP    351 - 420
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNT    421 - 490
ARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAIS    491 - 560
IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEF    561 - 630
GEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFM    631 - 700
ENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ    701 - 770
DDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD    771 - 840
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDF    841 - 910
TAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSP    911 - 980
TAMA                                                                      981 - 984
//

Text Mined References (65)

PMID Year Title