Property Summary

NCBI Gene PubMed Count 59
Grant Count 65
R01 Count 40
Funding $5,044,793.48
PubMed Score 48.22
PubTator Score 36.69

Knowledge Summary

Patent (156,871)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.600 0.002
posterior fossa group A ependymoma -1.400 0.000
oligodendroglioma 1.700 0.002
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -4.000 0.000
pancreatic ductal adenocarcinoma liver m... -1.828 0.000
non-small cell lung cancer 1.412 0.000
psoriasis -1.100 0.000
breast carcinoma -1.300 0.000
spina bifida -1.268 0.017
Breast cancer -4.100 0.000
pituitary cancer 3.100 0.000

Synonym

Accession P54762 A8K593 B3KTB2 B5A969 O43569 O95142 O95143 Q0VG87
Symbols ELK
NET
Hek6
EPHT2

Gene

PDB

2DJS   2EAO   3ZFX  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (27)

PMID Text
25944917 The tumor-suppressor function of EphB1 is clinically relevant across many malignancies, suggesting that EphB1 is an important regulator of common cancer cell transforming pathways.
25879388 In medulloblastoma cell lines, EphB1 downregulation or knockdown reduced cell growth, viability, cell-cycle regulator expression, and migration, but increased radiosensitivity and the percentage of cells in G1 phase of the cell cycle.
25120806 Our results indicate that EphB1 may be involved in carcinogenesis of renal cell carcinoma
24716914 The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies.
24677421 The study presents the first structure of the EphB1 tyrosine kinase domain determined by X-ray crystallography to 2.5A.
24606480 EphB1 and Ephrin-B could be regarded as independent good prognostic factors and important biological markers for Squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
24427352 Our data indicate that loss of EphB1 protein is associated with metastasis and poorer survival in patients with serous ovarian cancer
24121831 Low EphB1 expression is associated with glioma.
23118026 EphB1 stimulation triggered approximately 50% serine-threonine PTEN dephosphorylation and PTEN-Cbl complex disruption, a process requiring PTEN protein phosphatase activity.
21804545 Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion.
More...

AA Sequence

MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNN      1 - 70
WLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTI     71 - 140
AADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETM    141 - 210
TGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQE    211 - 280
AEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGG    281 - 350
RDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP    351 - 420
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNT    421 - 490
ARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAIS    491 - 560
IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEF    561 - 630
GEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFM    631 - 700
ENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ    701 - 770
DDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD    771 - 840
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDF    841 - 910
TAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSP    911 - 980
TAMA                                                                      981 - 984
//

Text Mined References (62)

PMID Year Title
25944917 2015 EphB1 Suppression in Acute Myelogenous Leukemia: Regulating the DNA Damage Control System.
25879388 2015 Knockdown of EphB1 receptor decreases medulloblastoma cell growth and migration and increases cellular radiosensitization.
25120806 2014 Decreased expression of receptor tyrosine kinase of EphB1 protein in renal cell carcinomas.
24716914 2014 Increased expression of P2RY2, CD248 and EphB1 in gastric cancers from Chilean patients.
24677421 2014 Completing the structural family portrait of the human EphB tyrosine kinase domains.
24606480 2014 EphB1 and Ephrin-B, new potential biomarkers for squamous cell/adenosquamous carcinomas and adenocarcinomas of the gallbladder.
24427352 2014 Loss of expression of EphB1 protein in serous carcinoma of ovary associated with metastasis and poor survival.
24121831 2013 Ligand-dependent EphB1 signaling suppresses glioma invasion and correlates with patient survival.
23118026 2013 Phosphatase and tensin homolog regulates stability and activity of EphB1 receptor.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
More...