Property Summary

NCBI Gene PubMed Count 107
Grant Count 100
R01 Count 47
Funding $7,781,037.1
PubMed Score 184.71
PubTator Score 156.00

Knowledge Summary

Patent (57,679)

Expression

  Differential Expression (8)

Synonym

Accession P54760 B5A970 B5A971 B5A972 Q7Z635 Q9BTA5 Q9BXP0
Symbols HTK
MYK1
TYRO11

Gene

PDB

2BBA   2E7H   2HLE   2QKQ   2VWU   2VWV   2VWW   2VWX   2VWY   2VWZ   2VX0   2VX1   2X9F   2XVD   2YN8   3ZEW   4AW5   4BB4  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720 screening 143 / 0 / 96746 Primary biochemical high-throughput screening assay for antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide probe
835 confirmatory 5 / 0 / 123 Dose-response biochemical assay for antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide
1669 summary 0 / 0 / 0 Summary of the probe development efforts to identify antagonists of the interaction between the Eph receptor B4 (EphB4) and its ligand ephrin-B2 via TNYL-RAW peptide
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (82)

PMID Text
26481148 Results indicate EphB4 receptor as a critical mediator of erythropoietin-induced tumor progression.
26414866 EPHB4 oncogenomic network provides a molecular basis for its role in tumor progression and points to EPHB4 as a potential tumor aggressiveness biomarker and drug target in gastroesophageal cancers
26191333 Suggest role for EphB4/IGF1R signaling in regulation proliferation/migration of breast cancer cells.
26132739 CTLA4 modification maintains EphB4 expression in mesenchymal stem cells under immune activation conditions.
26073592 Novel EPHB4 receptor tyrosine kinase mutations have been found in lung cancer patients.
26033476 EphB4 facilitates stromal-mediated support of hematopoiesis in hematopoietic stem cells.
25886373 EphB4 regulates integrin Beta8 expression and integrin Beta8 plays a role in prostate cancer cells.
25724901 EphB4 contains two nuclear localization signal sequences and localises to the nucleus.
25581780 N-(2,4)-dinitrophenyl-L-arginine Interacts with EphB4 and Functions as an EphB4 Kinase Modulator.
25446283 Stimulation of Eph-B4 function may be a candidate strategy for translation to human clinical trials designed to inhibit venous neointimal hyperplasia.
More...

AA Sequence

MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQA      1 - 70
HWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDT     71 - 140
VAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPET    141 - 210
VPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLS    211 - 280
GEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESG    281 - 350
GREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV    351 - 420
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSEN    421 - 490
RAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAV    491 - 560
LCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVC    561 - 630
RGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA    631 - 700
LDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSS    701 - 770
DPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP    771 - 840
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFG    841 - 910
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGT    911 - 980
GGPAPQY                                                                   981 - 987
//

Text Mined References (116)

PMID Year Title
26481148 2015 Erythropoietin Stimulates Tumor Growth via EphB4.
26414866 2016 Differential protein expression and oncogenic gene network link tyrosine kinase ephrin B4 receptor to aggressive gastric and gastroesophageal junction cancers.
26191333 2015 The role of EphB4 and IGF-IR expression in breast cancer cells.
26132739 2015 EphB4 Promotes Osteogenesis of CTLA4-Modified Bone Marrow-Derived Mesenchymal Stem Cells Through Cross Talk with Wnt Pathway in Xenotransplantation.
26073592 2015 Novel EPHB4 Receptor Tyrosine Kinase Mutations and Kinomic Pathway Analysis in Lung Cancer.
26033476 2015 EphB4 Expressing Stromal Cells Exhibit an Enhanced Capacity for Hematopoietic Stem Cell Maintenance.
25886373 2015 The tumour-promoting receptor tyrosine kinase, EphB4, regulates expression of integrin-?8 in prostate cancer cells.
25724901 2015 EphB4 localises to the nucleus of prostate cancer cells.
25581780 2015 N-(2,4)-dinitrophenyl-L-arginine Interacts with EphB4 and Functions as an EphB4 Kinase Modulator.
25446283 2016 Ephrin type-B receptor 4 activation reduces neointimal hyperplasia in human saphenous vein in vitro.
More...