Property Summary

NCBI Gene PubMed Count 35
Grant Count 23
R01 Count 13
Funding $3,686,827.93
PubMed Score 184.50
PubTator Score 30.54

Knowledge Summary

Patent (13,013)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.003
posterior fossa group B ependymoma -3.000 0.000
oligodendroglioma -2.500 0.005
glioblastoma -4.600 0.000
osteosarcoma 1.738 0.028
medulloblastoma -4.400 0.000
cystic fibrosis -1.382 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.300 0.031
interstitial cystitis -1.100 0.003
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -1.400 0.049

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (10)

PMID Text
25623065 demonstrate that a new monoclonal antibody against human EphA5 sensitized lung cancer cells and human lung cancer xenografts to radiotherapy and significantly prolonged survival, thus suggesting the likelihood of translational applications
25609195 Our study provides evidence that EphA5 is a potential target for epigenetic silencing in primary prostate cancer and is a potentially valuable prognosis predictor and thereapeutic marker for prostate cancer.
24086308 unbound EphA5 LBD appears to comprise an ensemble of open conformations that have only small variations over the loops and appear ready to bind ephrin-A ligands
24029132 These results indicate that EphA5 may be a negative regulator of bone formation.
23824631 Insertional translocation leading to a 4q13 duplication including the EPHA5 gene is associated with attention-deficit. hyperactivity disorder
22079638 these data suggest that miR-34a is a negative modulator of chondrogenesis, particularly in migration of chondroblasts, by targeting EphA5 and resulting inhibition of cellular condensation during chondrogenesis of chick limb mesenchymal cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19949912 Eph-A5 and Eph-A7 staining intensity was identified as independent prognostic factors for pancreatic ductal adenocarcinoma
19733895 EphA5 might be a potential target for epigenetic silencing in primary breast cancer and a valuable molecular marker for breast cancer carcinogenesis and progression.
16737551 increased levels of ephrins A1 and A5 in the presence of high expression of Ephs A1 and A2 lead to a more aggressive ovarian cancer phenotype

AA Sequence

MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVM      1 - 70
GDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSL     71 - 140
PGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGF    141 - 210
YLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEG    211 - 280
EWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPP    281 - 350
TMACTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG    351 - 420
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQ    421 - 490
EPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETT    491 - 560
PVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDP    561 - 630
EEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKR    631 - 700
ELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDG    701 - 770
QFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI    771 - 840
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQL    841 - 910
MLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMG    911 - 980
RYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL                 981 - 1037
//

Text Mined References (39)

PMID Year Title
25623065 2015 Receptor tyrosine kinase EphA5 is a functional molecular target in human lung cancer.
25609195 2015 Downregulation of EphA5 by promoter methylation in human prostate cancer.
24086308 2013 Unique structure and dynamics of the EphA5 ligand binding domain mediate its binding specificity as revealed by X-ray crystallography, NMR and MD simulations.
24029132 2013 After repeated division, bone marrow stromal cells express inhibitory factors with osteogenic capabilities, and EphA5 is a primary candidate.
23824631 2013 Insertional translocation leading to a 4q13 duplication including the EPHA5 gene in two siblings with attention-deficit hyperactivity disorder.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
22079638 2011 MicroRNA-34a regulates migration of chondroblast and IL-1?-induced degeneration of chondrocytes by targeting EphA5.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19949912 2010 Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma.
19733895 2010 Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer.
More...