Property Summary

Ligand Count 8
NCBI Gene PubMed Count 39
PubMed Score 191.70
PubTator Score 30.54

Knowledge Summary

Patent (13,013)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 3.8e-02
astrocytic glioma -1.600 1.9e-03
Astrocytoma, Pilocytic -1.100 3.3e-02
atypical teratoid / rhabdoid tumor -3.500 2.8e-04
cystic fibrosis -1.273 9.9e-05
ependymoma -1.700 1.0e-02
glioblastoma -2.000 9.1e-07
group 4 medulloblastoma -2.100 6.5e-04
interstitial cystitis -1.100 3.0e-03
medulloblastoma, large-cell -3.800 4.6e-04
oligodendroglioma -1.800 6.7e-04
osteosarcoma 1.738 2.8e-02
primitive neuroectodermal tumor -2.300 3.1e-02

Gene RIF (14)

AA Sequence

MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVM      1 - 70
GDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSL     71 - 140
PGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGF    141 - 210
YLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEG    211 - 280
EWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPP    281 - 350
TMACTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG    351 - 420
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQ    421 - 490
EPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETT    491 - 560
PVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDP    561 - 630
EEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKR    631 - 700
ELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDG    701 - 770
QFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI    771 - 840
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQL    841 - 910
MLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMG    911 - 980
RYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL                 981 - 1037
//

Text Mined References (43)

PMID Year Title