Property Summary

NCBI Gene PubMed Count 30
Grant Count 35
R01 Count 18
Funding $2,255,207.6
PubMed Score 43.18
PubTator Score 39.13

Knowledge Summary

Patent (48,280)

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 2.179 0.000
glioblastoma 1.400 0.020
primitive neuroectodermal tumor 1.100 0.020
primary pancreatic ductal adenocarcinoma -1.434 0.000
non-small cell lung cancer 1.880 0.000
group 3 medulloblastoma -1.100 0.043
lung adenocarcinoma 1.400 0.000
non-inflammatory breast cancer -1.500 0.024
lung carcinoma 1.600 0.000
pancreatic cancer -1.300 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
25277775 results identify EPHB3 as a novel target of SNAIL1 and suggest that disabling EPHB3 signaling is an important aspect to eliminate a roadblock at the onset of EMT processes.
24707046 These results uncover enhancer decommissioning as a mechanism for transcriptional silencing of the EPHB3 tumor suppressor.
22314363 EphB3 suppresses non-small-cell lung cancer metastasis via a PP2A/RACK1/Akt signalling complex
22039307 Our work shows that EphB3 is consistently expressed by malignant T lymphocytes, most frequently in combination with EphB6, and that stimulation with their common ligands strongly suppresses Fas-induced apoptosis in these cells.
21804545 Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion.
21266352 EphB3 provides critical support to the development and progression of NSCLC by stimulating cell growth, migration, and survival.
21106840 Ephrin B3 receptor regulates the synthesis and release of D-serine in astrocytes, which may have important implications on synaptic transmission and plasticity.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19607727 EPHB3, MASP1 and SST map to 3q26.2-q29 and may have roles in squamous cell carcinoma of the lung
19483190 EphB3-ephrin-B interaction promotes mesenchymal-to-epithelial transition (MET) by re-establishing epithelial cell-cell junctions and such an MET-promoting effect contributes to EphB3-mediated tumor suppression.
More...

AA Sequence

MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPESGWEEVSGYDE      1 - 70
AMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSD     71 - 140
VASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYK    141 - 210
KCASTTAGFALFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAK    211 - 280
ESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNV    281 - 350
NETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR    351 - 420
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKY    421 - 490
FEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSERGSGAQQLQEQLPLI    491 - 560
VGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDV    561 - 630
SCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGV    631 - 700
VTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNL    701 - 770
VCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW    771 - 840
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQS    841 - 910
GMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKIL    911 - 980
SSIQDMRLQMNQTLPVQV                                                        981 - 998
//

Text Mined References (32)

PMID Year Title
25277775 2015 SNAIL1 combines competitive displacement of ASCL2 and epigenetic mechanisms to rapidly silence the EPHB3 tumor suppressor in colorectal cancer.
24707046 2014 Silencing of the EPHB3 tumor-suppressor gene in human colorectal cancer through decommissioning of a transcriptional enhancer.
22314363 2012 EphB3 suppresses non-small-cell lung cancer metastasis via a PP2A/RACK1/Akt signalling complex.
22039307 2011 EphB receptors trigger Akt activation and suppress Fas receptor-induced apoptosis in malignant T lymphocytes.
21804545 2011 Cleavage of E-cadherin by ADAM10 mediates epithelial cell sorting downstream of EphB signalling.
21266352 2011 EphB3 is overexpressed in non-small-cell lung cancer and promotes tumor metastasis by enhancing cell survival and migration.
21106840 2010 EphrinBs regulate D-serine synthesis and release in astrocytes.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19607727 2009 Identification of novel candidate target genes, including EPHB3, MASP1 and SST at 3q26.2-q29 in squamous cell carcinoma of the lung.
More...