Property Summary

Ligand Count 14
NCBI Gene PubMed Count 28
PubMed Score 21.31
PubTator Score 23.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-02
astrocytic glioma -3.400 6.9e-03
Astrocytoma, Pilocytic -1.100 4.3e-02
atypical teratoid / rhabdoid tumor -2.300 4.2e-04
Breast cancer -2.300 3.3e-02
colon cancer -1.700 3.1e-04
ependymoma -2.800 2.4e-02
glioblastoma -1.200 2.8e-03
group 4 medulloblastoma -1.900 1.7e-03
interstitial cystitis 1.100 6.3e-03
intraductal papillary-mucinous adenoma (... -1.900 3.4e-04
intraductal papillary-mucinous carcinoma... -2.800 5.6e-05
intraductal papillary-mucinous neoplasm ... -2.900 4.5e-04
invasive ductal carcinoma -1.500 1.2e-03
lung cancer 3.900 2.9e-05
malignant mesothelioma -2.500 1.2e-08
medulloblastoma, large-cell -1.300 4.8e-04
oligodendroglioma -2.100 3.6e-02
osteosarcoma -1.699 1.1e-02
ovarian cancer -1.100 7.2e-13
Pick disease -1.200 1.7e-02
primitive neuroectodermal tumor -2.900 1.3e-02
progressive supranuclear palsy 1.200 2.2e-02
subependymal giant cell astrocytoma -2.537 2.6e-03
X-linked cerebral adrenoleukodystrophy -2.000 3.6e-02

Gene RIF (15)

AA Sequence

MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAASVLEAVYIDE      1 - 70
TRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYH     71 - 140
MVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLITFAEALEVG    141 - 210
YSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAI    211 - 280
LYNDRSVLENHHVSAAYRLMQEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE    281 - 350
GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF    351 - 420
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDY    421 - 490
SLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ                             491 - 535
//

Text Mined References (29)

PMID Year Title