Property Summary

NCBI Gene PubMed Count 28
Grant Count 17
R01 Count 7
Funding $2,261,162.16
PubMed Score 18.14
PubTator Score 23.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26464516 Report significant associations of PDE1A single nucleotide polymorphisms with diastolic blood pressure and carotid intima-media thickness.
22012077 These results suggest that induction of PDE1A plays a critical role in cardiac fibroblast activation and cardiac fibrosis
20807569 PDE1A is suggested to be involved in epigenetic mechanisms by targeting the epigenetic integrator UHRF1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19557111 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19214142 PDE1A is unlikely to play an important role in antidepressant outcome in this sample
19214142 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAASVLEAVYIDE      1 - 70
TRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYH     71 - 140
MVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLITFAEALEVG    141 - 210
YSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAI    211 - 280
LYNDRSVLENHHVSAAYRLMQEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE    281 - 350
GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF    351 - 420
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDY    421 - 490
SLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ                             491 - 535
//

Text Mined References (29)

PMID Year Title
26464516 2015 Phosphodiesterase 1 regulation is a key mechanism in vascular aging.
22012077 2011 Cyclic nucleotide phosphodiesterase 1A: a key regulator of cardiac fibroblast activation and extracellular matrix remodeling in the heart.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
20807569 2011 Down-regulation of cyclic nucleotide phosphodiesterase PDE1A is the key event of p73 and UHRF1 deregulation in thymoquinone-induced acute lymphoblastic leukemia cell apoptosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19557111 2009 Association of PDE11A global haplotype with major depression and antidepressant drug response.
19214142 2009 Association study of phosphodiesterase genes in the Sequenced Treatment Alternatives to Relieve Depression sample.
More...