Property Summary

NCBI Gene PubMed Count 85
Grant Count 78
R01 Count 71
Funding $5,938,335.25
PubMed Score 88.57
PubTator Score 62.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
interstitial lung disease -1.700 0.018
Waldenstrons macroglobulinemia 1.033 0.018
Multiple myeloma 1.558 0.004
osteosarcoma 1.205 0.000
hereditary spastic paraplegia -1.217 0.049
tuberculosis and treatment for 6 months 1.400 0.000
lung cancer 1.400 0.008
Breast cancer 3.000 0.025
group 3 medulloblastoma 1.200 0.004
lung adenocarcinoma 2.298 0.000
ovarian cancer 2.400 0.000
dermatomyositis -1.300 0.013

Synonym

Accession P54727 B3KWK8 G5E9P0 Q7Z5K8 Q8WUB0 HR23B
Symbols P58
HR23B
HHR23B

Gene

PDB

1P1A   1PVE   1UEL  

Gene RIF (50)

PMID Text
26170451 Data show that nucleotide excision repair factor XPC-RAD23B is a target of poly(ADP-ribosyl)ation catalyzed by poly(ADP-ribose) polymerase 1 (PARP1).
25311859 Data indicate that phosphorylation provides a mechanism to regulate Rad23/proteasome interaction.
24897598 RAD23B has a potential role in breast cancer progression and a tumor suppressor role of nuclear RAD23B in breast cancer.
24643114 It is unlikely that the RAD23B 249Val/Val polymorphism may contribute to the individual susceptibility to cancer risk.
23776089 Polymorphism in RAD23B gene is associated with breast cancer.
23703321 Results define a regulatory mechanism that involves the interplay between HR23B and HDAC6 that influences the biological outcome of HDAC inhibitor treatment.
22915658 HR23B expression was associated with disease stabilization for patients with unresectable hepatocellular carcinoma treated with epigenetic therapy using belinostat, a histone deacetylase inhibitor.
22575648 PNGase-PUB serves not only as p97-binding module but also as a possible activator of HR23 in endoplasmic reticulum-associated degradation mechanisms.
22004425 Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus.
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFV      1 - 70
VVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPA     71 - 140
SAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAA    141 - 210
LRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLR    211 - 280
NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIA    281 - 350
EAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED               351 - 409
//

Text Mined References (104)

PMID Year Title
26170451 2015 Poly(ADP-ribose) Polymerase 1 Modulates Interaction of the Nucleotide Excision Repair Factor XPC-RAD23B with DNA via Poly(ADP-ribosyl)ation.
25416956 2014 A proteome-scale map of the human interactome network.
25311859 2014 Rad23 interaction with the proteasome is regulated by phosphorylation of its ubiquitin-like (UbL) domain.
24897598 2014 Identification and functional validation of RAD23B as a potential protein in human breast cancer progression.
24643114 2014 The association between RAD23B Ala249Val polymorphism and cancer susceptibility: evidence from a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23776089 2013 Genetic polymorphisms in RAD23B and XPC modulate DNA repair capacity and breast cancer risk in Puerto Rican women.
23703321 2013 A regulatory circuit that involves HR23B and HDAC6 governs the biological response to HDAC inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023329 2012 Genome-wide association study in Chinese men identifies two new prostate cancer risk loci at 9q31.2 and 19q13.4.
More...