Property Summary

NCBI Gene PubMed Count 87
PubMed Score 96.77
PubTator Score 62.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 3.000 2.5e-02
dermatomyositis -1.300 1.3e-02
group 3 medulloblastoma 1.200 3.9e-03
hereditary spastic paraplegia -1.217 4.9e-02
interstitial lung disease -1.700 1.8e-02
lung adenocarcinoma 2.298 2.9e-05
lung cancer 1.400 8.2e-03
Multiple myeloma 1.558 3.5e-03
osteosarcoma 1.205 3.0e-05
ovarian cancer -1.700 1.1e-04
tuberculosis and treatment for 6 months 1.400 1.3e-05
Waldenstrons macroglobulinemia 1.033 1.8e-02

Protein-protein Interaction (9)

Gene RIF (52)

AA Sequence

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFV      1 - 70
VVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPA     71 - 140
SAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAA    141 - 210
LRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLR    211 - 280
NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIA    281 - 350
EAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED               351 - 409
//

Text Mined References (106)

PMID Year Title