Property Summary

NCBI Gene PubMed Count 60
PubMed Score 35.70
PubTator Score 55.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.3e-08
ovarian cancer 8520 2.5e-04
Duchenne muscular dystrophy 601 2.9e-04
psoriasis 6694 4.2e-04
Disease Target Count Z-score Confidence
Xeroderma pigmentosum 43 4.292 2.1
Machado-Joseph disease 18 3.879 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Duchenne muscular dystrophy -1.023 2.9e-04
osteosarcoma -1.668 3.3e-08
ovarian cancer 1.200 2.5e-04
psoriasis 1.100 4.2e-04

Protein-protein Interaction (1)

Gene RIF (41)

AA Sequence

MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN      1 - 70
FVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGS     71 - 140
VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEH    141 - 210
GSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQF    211 - 280
IQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENL    281 - 350
AANFLLSQNFDDE                                                             351 - 363
//

Text Mined References (72)

PMID Year Title