Property Summary

NCBI Gene PubMed Count 58
PubMed Score 35.66
PubTator Score 55.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 5.3740650127351E-9
osteosarcoma 7933 3.29151232673541E-8
Duchenne muscular dystrophy 602 2.92332458650964E-4
psoriasis 6685 4.21550864491219E-4
Disease Target Count Z-score Confidence
Xeroderma pigmentosum 41 4.152 2.1
Machado-Joseph disease 18 3.932 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.100 0.000
osteosarcoma -1.668 0.000
Duchenne muscular dystrophy -1.023 0.000
ovarian cancer 2.200 0.000

Synonym

Accession P54725 K7ESE3 Q59EU8 Q5M7Z1 HR23A
Symbols HR23A
HHR23A

Gene

PDB

1DV0   1F4I   1IFY   1OQY   1P98   1P9D   1QZE   1TP4   1ZO6   2WYQ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (39)

PMID Text
26296656 hHR23A associates with Chk1 through its ubiquitin-associated domains, and knockdown of hHR23A increases and stabilizes the protein level of Chk1 and its phosphorylation at S347.
25311859 Data indicate that phosphorylation provides a mechanism to regulate Rad23/proteasome interaction.
24318982 Here, we show that hHR23A utilizes both the UBA2 and XPCB domains to form a stable complex with Vpr, linking Vpr directly to cellular DNA repair pathways and their probable exploitation by the virus.
24318982 Binding of HIV-1 Vpr (amino acids 25-77) to the UBA(2) domain of RAD23A (HHR23A) (amino acids 319-363) affects the cell cycle arrest induced by Vpr
23357418 this study identified RAD23A as a novel negative regulator of RIG-I/MDA5 mediated anti-virus response.
21318276 Binding of HIV-1 Vpr (amino acids 25-77) to the UBA(2) domain of RAD23A (HHR23A) (amino acids 319-363) affects the cell cycle arrest induced by Vpr
21047872 Determined is the three-dimensional structure of its ubiquitin-like (UbL) domain by X-ray crystallography.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20614012 Vpr promotes hHR23A-mediated protein-ubiquitination, and down-regulation of hHR23A using RNAi significantly reduced viral replication in non-proliferating MAGI-CCR5 cells and primary macrophages
20614012 Binding of HIV-1 Vpr (amino acids 25-77) to the UBA(2) domain of RAD23A (HHR23A) (amino acids 319-363) affects the cell cycle arrest induced by Vpr
More...

AA Sequence

MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN      1 - 70
FVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGS     71 - 140
VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEH    141 - 210
GSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQF    211 - 280
IQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENL    281 - 350
AANFLLSQNFDDE                                                             351 - 363
//

Text Mined References (70)

PMID Year Title
26296656 2015 hHR23A is required to control the basal turnover of Chk1.
25416956 2014 A proteome-scale map of the human interactome network.
25311859 2014 Rad23 interaction with the proteasome is regulated by phosphorylation of its ubiquitin-like (UbL) domain.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24318982 2014 Binding of HIV-1 Vpr protein to the human homolog of the yeast DNA repair protein RAD23 (hHR23A) requires its xeroderma pigmentosum complementation group C binding (XPCB) domain as well as the ubiquitin-associated 2 (UBA2) domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23357418 2013 RAD23A negatively regulates RIG-I/MDA5 signaling through promoting TRAF2 polyubiquitination and degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22970133 2012 Valosin-containing protein (VCP/p97) is an activator of wild-type ataxin-3.
22575648 2012 NMR characterization of the interaction between the PUB domain of peptide:N-glycanase and ubiquitin-like domain of HR23.
More...