Property Summary

Ligand Count 3
NCBI Gene PubMed Count 33
PubMed Score 39.01
PubTator Score 30.67

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (15)

AA Sequence

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP          1 - 66
//

Text Mined References (33)

PMID Year Title