Property Summary

NCBI Gene PubMed Count 33
PubMed Score 23.86
PubTator Score 30.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

PDB

2MKV  

 MGI Term (1)

Gene RIF (15)

PMID Text
25765846 Recurrent FXYD2 p.Gly41Arg mutation is associated with isolated dominant hypomagnesaemia.
24794573 FXYD2b could regulate the Na,K-ATPase by modulating the effective membrane surface electrostatics near the ion binding sites of the pump.
24258619 our findings suggested that FXYD2c played a role in regulation of NKA activity by enhancing the expression of NKA in HK-2 cells upon hypertonic challenge.
24204001 PCBD1 (dimerization cofactor of HNF-1alpha) is coactivator of the HNF1B-mediated transcription necessary for fine tuning ATPase Na+/K+ transporting gamma 1 polypeptide (FXYD2) transcription in the distal convoluted tubule.
23196795 This is the first report demonstrating the potential utility of FXYD2 immunohistochemistry in the diagnosis of chromophobe renal cell carcinoma
22588134 findings confirm the presence of an FXYD2 peptide in the crab gill Na,K-ATPase and demonstrate that this peptide plays an important role in regulating enzyme activity
21130072 wild type HNF1B specifically induces FXYD2A transcription whereas all HNF1B mutants partially prevented it.
20379810 Datab propose human FXYD2gammaa as a novel beta cell-specific biomarker.
19879113 Study reveals, in various human tissues, the specific expression of FXYD2, which may associate with Na, K-ATPase in selected cell types and modulate its catalytic properties.
19865785 Data conclude that human proximal tubular cells respond to a hyperosmotic challenge with an increase in FXYD2 and Na,K-ATPase protein expression, though to a smaller absolute extent in patient cells.
More...

AA Sequence

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP          1 - 66
//

Text Mined References (33)

PMID Year Title
25765846 2015 Recurrent FXYD2 p.Gly41Arg mutation in patients with isolated dominant hypomagnesaemia.
24794573 2015 Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: implications for membrane-water interfacial arginines.
24258619 2014 FXYD2c plays a potential role in modulating Na(+)/K (+)-ATPase activity in HK-2 cells upon hypertonic challenge.
24204001 2014 Mutations in PCBD1 cause hypomagnesemia and renal magnesium wasting.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23196795 2013 Expression of the Na+/K+-transporting ATPase gamma subunit FXYD2 in renal tumors.
22588134 2012 Identification of a crab gill FXYD2 protein and regulation of crab microsomal Na,K-ATPase activity by mammalian FXYD2 peptide.
21130072 2011 HNF-1B specifically regulates the transcription of the ?a-subunit of the Na+/K+-ATPase.
20379810 2010 A genomic-based approach identifies FXYD domain containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker.
19879113 2010 Differential cellular expression of FXYD1 (phospholemman) and FXYD2 (gamma subunit of Na, K-ATPase) in normal human tissues: a study using high density human tissue microarrays.
More...