Property Summary

Ligand Count 3
NCBI Gene PubMed Count 25
PubMed Score 13.33
PubTator Score 7.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.900 3.4e-06
diabetes mellitus -1.500 2.1e-02
lung carcinoma -1.100 1.1e-06

Gene RIF (6)

AA Sequence

MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVP      1 - 70
KYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPV     71 - 140
YVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMI    141 - 210
DLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA     211 - 279
//

Text Mined References (28)

PMID Year Title