Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.94
PubTator Score 7.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.500 0.021
lung carcinoma -1.100 0.000
Breast cancer 1.900 0.000

Synonym

Accession P54709 B7Z1N7
Symbols CD298
ATPB-3

Gene

Gene RIF (5)

PMID Text
26694617 Data suggest that ATP1B3 is binding partner of BST-2 and regulates stability of BST-2; ATP1B3 is co-factor that accelerates BST-2 degradation and reduces BST-2-mediated restriction of HIV-1 replication/tropism and NFkappaB activation.
24236063 B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, favoring an angiogenic phenotype.
17446412 Elevated Na+ -K+ -ATPase activity postexercise may contribute to reduced fatigue after training.
17176442 These results evidenced that the beta3 subunit of Na, K ATPase is expressed on RBC membrane but the epitope recognized by mAb P-3E10 is hidden in normal RBCs. we showed the association of beta3 subunit and alpha subunit of Na, K ATPase.
12456588 role in T and B lymphocyte activation

AA Sequence

MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVP      1 - 70
KYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPV     71 - 140
YVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMI    141 - 210
DLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA     211 - 279
//

Text Mined References (27)

PMID Year Title
26694617 2016 ATP1B3 Protein Modulates the Restriction of HIV-1 Production and Nuclear Factor ? Light Chain Enhancer of Activated B Cells (NF-?B) Activation by BST-2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24236063 2013 Identification and characterization of angiogenesis targets through proteomic profiling of endothelial cells in human cancer tissues.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20065300 2010 Expression and distribution of Na, K-ATPase isoforms in the human uterus.
19542013 2009 Reversible oxidative modification: a key mechanism of Na+-K+ pump regulation.
18522992 2008 Fast degradation of the auxiliary subunit of Na+/K+-ATPase in the plasma membrane of HeLa cells.
17446412 2007 Muscle Na+-K+-ATPase activity and isoform adaptations to intense interval exercise and training in well-trained athletes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...