Property Summary

Ligand Count 10
NCBI Gene PubMed Count 23
PubMed Score 6449.48
PubTator Score 77.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 9.6e-11
psoriasis 6694 1.3e-09
cystic fibrosis 1696 1.4e-04
cutaneous lupus erythematosus 1057 1.5e-02
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Gastroesophageal reflux disease 110 8.838 4.0
Peptic ulcer disease 11 8.014 4.0
Esophagitis 35 7.961 4.0
Dyspepsia 33 7.378 3.7
Hiatus hernia 7 6.771 3.4
Barrett's esophagus 182 6.742 3.4
Gastritis 47 6.633 3.3
Laryngitis 2 6.005 3.0
Zollinger-Ellison syndrome 18 5.774 2.9
Diarrhea 253 5.408 2.7
Achalasia 13 5.181 2.6
Cancer 2499 4.91 2.5
Pneumonia 174 4.87 2.4
Dyskinesia of esophagus 10 4.86 2.4
Allergic hypersensitivity disease 126 4.852 2.4
Hypereosinophilic syndrome 71 4.821 2.4
Bile reflux 9 4.808 2.4
Duodenitis 7 4.525 2.3
Coronary artery disease 268 4.439 2.2
Gastric outlet obstruction 6 4.262 2.1
Asthma 385 4.233 2.1
Irritable bowel syndrome 60 4.106 2.1
Kidney disease 430 4.04 2.0
Constipation 181 3.961 2.0
Osteoporosis 363 3.948 2.0
Inflammatory bowel disease 151 3.891 1.9
Vitamin B12 deficiency 20 3.879 1.9
Liver disease 237 3.862 1.9
Anemia 365 3.726 1.9
Cerebrovascular disease 238 3.706 1.9
Osteopetrosis 43 3.668 1.8
Gastric antral vascular ectasia 10 3.643 1.8
Gastroparesis 22 3.622 1.8
Duodenogastric reflux 8 3.596 1.8
Peritonitis 43 3.565 1.8
diabetes mellitus 1728 3.543 1.8
Hypersensitivity reaction type II disease 253 3.457 1.7
Arthritis 290 3.444 1.7
Pernicious anemia 9 3.352 1.7
Pain disorder 15 3.351 1.7
Chronic intestinal vascular insufficiency 12 3.346 1.7
Gastroenteritis 41 3.345 1.7
X-linked myopathy with excessive autophagy 2 3.307 1.7
Esophageal atresia 43 3.286 1.6
Varicose veins 20 3.219 1.6
Dementia 175 3.153 1.6
Atrial Fibrillation 124 3.136 1.6
Esophageal varix 12 3.101 1.6
Candidiasis 55 3.026 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 1.5e-02
cystic fibrosis -1.200 1.4e-04
nasopharyngeal carcinoma -2.400 9.6e-11
psoriasis 3.600 1.3e-09

Gene RIF (11)

AA Sequence

MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKY      1 - 70
GTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSA     71 - 140
SLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKG    141 - 210
GDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRT    211 - 280
IIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEG    281 - 350
LLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED    351 - 420
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILGDVMEIRKRNR    421 - 490
KVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMINGEEHPLDKSTAKTFHTAYMEL    491 - 560
GGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIM    561 - 630
VTGDHPITAKAIAKSVGIISANSETVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANY    631 - 700
QEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNF    701 - 770
ASIVTGVEEGRLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE    771 - 840
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLINLRVEWEKDYV    841 - 910
NDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGITSQIII    911 - 980
GLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEVRKLFIRLYPGSWWDKNMYY               981 - 1039
//

Text Mined References (27)

PMID Year Title