Property Summary

NCBI Gene PubMed Count 33
Grant Count 16
R01 Count 16
Funding $1,554,600.17
PubMed Score 67.26
PubTator Score 38.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26372729 BCAT1 is strongly overexpressed in ovarian cancer.
26173071 BCAT1 overexpression is associated with advanced tumour status, and implies adverse clinical outcomes of urothelial carcinoma
25261097 Focal deletions of the BCAT1 were associated with B-cell precursor acute lymphoblastic leukemia.
24463277 levels of branched-chain aminotransferase-1 (BCAT1) transcripts are significantly decreased on the polysomes of both RPS19 and RPL11 cells and that translation of BCAT1 protein is especially impaired in cells with small RP gene mutations
23793099 A central role for BCAT1 in glioma pathogenesis, making BCAT1 and branched-chain amino acids metabolism attractive targets for the development of targeted therapeutic approaches to treat patients with glioblastoma.
23758864 Over-expression of BCAT1, a c-Myc target gene, induces cell proliferation, migration and invasion in nasopharyngeal carcinoma.
23043456 The mitochondrial isoform human brain BCAT 2 is largely confined to vascular endothelial cells, whereas the cytosolic human brain BCAT 1 is restricted to neurons.
22107788 BCATc (cytosolic) has an overall redox potential that is 30 mV lower than BCATm (mitochondrial). Furthermore, the CXXC motif of BCATc was estimated to be 80 mV lower, suggesting that BCATm is more oxidizing in nature.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK      1 - 70
PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC     71 - 140
IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY    141 - 210
VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP    211 - 280
LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI    281 - 350
HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS                                      351 - 386
//

Text Mined References (38)

PMID Year Title
26372729 2015 BCAT1 expression associates with ovarian cancer progression: possible implications in altered disease metabolism.
26173071 2016 BCAT1 overexpression is an indicator of poor prognosis in patients with urothelial carcinomas of the upper urinary tract and urinary bladder.
25261097 2015 Novel gene targets detected by genomic profiling in a consecutive series of 126 adults with acute lymphoblastic leukemia.
24463277 2014 Translation of branched-chain aminotransferase-1 transcripts is impaired in cells haploinsufficient for ribosomal protein genes.
23793099 2013 BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
23758864 2013 Over-expression of BCAT1, a c-Myc target gene, induces cell proliferation, migration and invasion in nasopharyngeal carcinoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23043456 2012 Distribution of the branched chain aminotransferase proteins in the human brain and their role in glutamate regulation.
22107788 2012 Differential redox potential between the human cytosolic and mitochondrial branched-chain aminotransferase.
21269460 2011 Initial characterization of the human central proteome.
More...