Property Summary

Ligand Count 4
NCBI Gene PubMed Count 39
PubMed Score 78.09
PubTator Score 38.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (32)

Disease log2 FC p
adult high grade glioma 1.200 9.8e-03
aldosterone-producing adenoma -1.842 4.5e-02
astrocytic glioma -2.400 1.3e-02
Astrocytoma, Pilocytic 1.400 1.3e-05
atypical teratoid / rhabdoid tumor 1.400 5.1e-04
Breast cancer 1.600 8.2e-07
chronic lymphosyte leukemia 1.200 2.0e-02
cystic fibrosis 2.600 1.2e-04
Duchenne muscular dystrophy 1.242 1.6e-07
ependymoma -2.300 4.0e-02
gastric carcinoma 1.500 3.0e-02
glioblastoma 1.700 4.8e-06
group 3 medulloblastoma -1.700 2.3e-02
head and neck cancer and chronic obstruc... 1.400 3.5e-03
intraductal papillary-mucinous adenoma (... -2.900 5.2e-04
intraductal papillary-mucinous carcinoma... -3.100 3.9e-04
intraductal papillary-mucinous neoplasm ... -3.000 5.9e-03
invasive ductal carcinoma 1.401 3.1e-03
lung carcinoma -1.700 2.7e-11
medulloblastoma, large-cell 2.100 7.8e-04
non-small cell lung cancer 1.007 1.5e-04
oligodendroglioma -2.400 1.9e-02
osteosarcoma 2.575 1.8e-03
ovarian cancer 1.700 4.6e-04
pancreatic cancer 1.200 1.9e-03
pancreatic carcinoma 1.200 1.9e-03
pancreatic ductal adenocarcinoma liver m... 1.466 3.3e-02
pituitary cancer -2.100 1.2e-08
Polycystic ovary syndrome -1.196 5.0e-02
primary Sjogren syndrome 1.100 4.6e-04
tuberculosis -1.700 2.5e-05
ulcerative colitis 2.300 1.0e-04

Gene RIF (26)

AA Sequence

MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK      1 - 70
PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC     71 - 140
IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY    141 - 210
VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP    211 - 280
LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI    281 - 350
HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS                                      351 - 386
//

Text Mined References (44)

PMID Year Title