Property Summary

NCBI Gene PubMed Count 33
PubMed Score 67.26
PubTator Score 38.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Weight Gain 87
Disease Target Count P-value
pituitary cancer 1972 1.29739565827793E-18
lung carcinoma 2844 2.69567719120335E-11
Breast cancer 3099 3.10018466770966E-8
Duchenne muscular dystrophy 602 1.56283056689414E-7
pilocytic astrocytoma 3086 1.64098942375408E-7
tuberculosis and treatment for 3 months 327 9.63870374411251E-7
ovarian cancer 8492 1.40585830424795E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.26543851137406E-5
ulcerative colitis 2087 3.17369770084071E-5
glioblastoma 5572 3.92085721355604E-5
pediatric high grade glioma 2712 5.29182672632087E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.65675719558811E-5
cystic fibrosis 1670 1.20089073493562E-4
non-small cell lung cancer 2798 1.50757296797944E-4
primary Sjogren syndrome 789 4.55666656848688E-4
atypical teratoid / rhabdoid tumor 4369 5.08936310967963E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.79011613115395E-4
medulloblastoma, large-cell 6234 7.80407223946008E-4
primary pancreatic ductal adenocarcinoma 1271 0.00131524687791047
invasive ductal carcinoma 2950 0.00168553592369052
osteosarcoma 7933 0.0017565336510095
pancreatic carcinoma 567 0.00202896068218856
sonic hedgehog group medulloblastoma 1482 0.00377189944915029
head and neck cancer and chronic obstructive pulmonary disease 237 0.00389871885949997
pancreatic cancer 2300 0.00539996406306005
astrocytic glioma 2241 0.0127209225124475
oligodendroglioma 2849 0.0191065428734775
chronic lymphosyte leukemia 232 0.0201243450727335
gastric carcinoma 832 0.0305666145290053
ependymoma 2514 0.0398264309493513
aldosterone-producing adenoma 664 0.0461295205458002
Polycystic Ovary Syndrome 335 0.0496095858411079
Disease Target Count Z-score Confidence
Serine deficiency 9 3.513 1.8
Maple syrup urine disease 25 3.303 1.7

Expression

Synonym

Accession P54687 B3KY27 B7Z2M5 B7Z5L0 F5H5E4 Q68DQ7 Q96MY9 BCAT(c)
Symbols BCT1
PP18
BCATC
ECA39
MECA39
PNAS121

Gene

PANTHER Protein Class (2)

PDB

2ABJ   2COG   2COI   2COJ  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (20)

PMID Text
26372729 BCAT1 is strongly overexpressed in ovarian cancer.
26173071 BCAT1 overexpression is associated with advanced tumour status, and implies adverse clinical outcomes of urothelial carcinoma
25261097 Focal deletions of the BCAT1 were associated with B-cell precursor acute lymphoblastic leukemia.
24463277 levels of branched-chain aminotransferase-1 (BCAT1) transcripts are significantly decreased on the polysomes of both RPS19 and RPL11 cells and that translation of BCAT1 protein is especially impaired in cells with small RP gene mutations
23793099 A central role for BCAT1 in glioma pathogenesis, making BCAT1 and branched-chain amino acids metabolism attractive targets for the development of targeted therapeutic approaches to treat patients with glioblastoma.
23758864 Over-expression of BCAT1, a c-Myc target gene, induces cell proliferation, migration and invasion in nasopharyngeal carcinoma.
23043456 The mitochondrial isoform human brain BCAT 2 is largely confined to vascular endothelial cells, whereas the cytosolic human brain BCAT 1 is restricted to neurons.
22107788 BCATc (cytosolic) has an overall redox potential that is 30 mV lower than BCATm (mitochondrial). Furthermore, the CXXC motif of BCATc was estimated to be 80 mV lower, suggesting that BCATm is more oxidizing in nature.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK      1 - 70
PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC     71 - 140
IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY    141 - 210
VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP    211 - 280
LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI    281 - 350
HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS                                      351 - 386
//

Text Mined References (38)

PMID Year Title
26372729 2015 BCAT1 expression associates with ovarian cancer progression: possible implications in altered disease metabolism.
26173071 2016 BCAT1 overexpression is an indicator of poor prognosis in patients with urothelial carcinomas of the upper urinary tract and urinary bladder.
25261097 2015 Novel gene targets detected by genomic profiling in a consecutive series of 126 adults with acute lymphoblastic leukemia.
24463277 2014 Translation of branched-chain aminotransferase-1 transcripts is impaired in cells haploinsufficient for ribosomal protein genes.
23793099 2013 BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
23758864 2013 Over-expression of BCAT1, a c-Myc target gene, induces cell proliferation, migration and invasion in nasopharyngeal carcinoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23043456 2012 Distribution of the branched chain aminotransferase proteins in the human brain and their role in glutamate regulation.
22107788 2012 Differential redox potential between the human cytosolic and mitochondrial branched-chain aminotransferase.
21269460 2011 Initial characterization of the human central proteome.
More...