Property Summary

NCBI Gene PubMed Count 67
Grant Count 22
R01 Count 9
Funding $1,281,319.9
PubMed Score 99.48
PubTator Score 94.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (52)

PMID Text
26676989 ACE and PDIA6 were identified as potential HSPA2-interacting proteins; this assemblage resides in membrane raft microdomains located in the peri-acrosomal region of the sperm head.
26164067 HSPA2 expression increased under conditions that stimulated HIF-1alpha activity, whereas inhibition of HIF-1alpha abrogated hypoxia-induced up-regulation of HSPA2 expression
25890028 Results suggest that overexpression of HSPA2 in pancreatic cancer is associated with aggressive progression and poor prognosis and that HSPA2 may be served as a prognostic marker.
25865850 we consider the evidence supporting the role of HSPA2 in sperm function and explore the potential mechanisms by which it is depleted in the spermatozoa of infertile patients--{REVIEW}
25308252 The fertilization rate with ICSI is associated with HspA2 expression in the testis from which sperm retrieved and the alteration of HspA2 expression has been involved in spermatogenic impairment.
25117073 High expression of HSPA2 is associated with hepatocellular carcinoma.
25108126 HSP70-2 +1267 polymorphism may influence the risk of coronary artery disease (CAD) in Iranian population, however further studies are needed to clarify the role of other HSP70-2 gene polymorphisms in the pathogenesis of the CAD.
24922646 High HSPA2 expression is associated with non-small cell lung carcinoma.
24485944 Genotype analysis of HSP70-2 (+1267 A/G) polymorphism revealed a significant association between the minor allele G and presence of Multiple Sclerosis
24051039 findings show polymorphisms of HSP70 genes are associated with the development of gastric cancer and duodenal ulcers in a population at high risk for gastric cancer in Costa Rica
More...

AA Sequence

MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFD      1 - 70
AKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKV     71 - 140
HSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDV    141 - 210
SILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSS    211 - 280
TQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQ    281 - 350
KLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN    351 - 420
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILN    421 - 490
VTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEK    491 - 560
LRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGAS    561 - 630
GGPTIEEVD                                                                 631 - 639
//

Text Mined References (70)

PMID Year Title
26676989 2016 Heat Shock Protein member A2 forms a stable complex with angiotensin converting enzyme and protein disulfide isomerase A6 in human spermatozoa.
26164067 2015 Cell type-dependent modulation of the gene encoding heat shock protein HSPA2 by hypoxia-inducible factor HIF-1: Down-regulation in keratinocytes and up-regulation in HeLa cells.
25890028 2015 Expression and clinical significance of HSPA2 in pancreatic ductal adenocarcinoma.
25865850 The role of the molecular chaperone heat shock protein A2 (HSPA2) in regulating human sperm-egg recognition.
25416956 2014 A proteome-scale map of the human interactome network.
25308252 2014 Depression of HspA2 in human testis is associated with spermatogenic impairment and fertilization rate in ICSI treatment for azoospermic individuals.
25117073 2014 Expression of HSPA2 in human hepatocellular carcinoma and its clinical significance.
25108126 2014 Association of heat shock protein70-2 (HSP70-2) gene polymorphism with coronary artery disease in an Iranian population.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24922646 2014 HSPA2 is expressed in human tumors and correlates with clinical features in non-small cell lung carcinoma patients.
More...