Property Summary

NCBI Gene PubMed Count 71
PubMed Score 104.29
PubTator Score 94.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 6.7e-03
Barrett's esophagus -1.300 2.7e-02
chronic rhinosinusitis -1.170 2.7e-02
colon cancer -2.800 1.0e-05
cystic fibrosis -1.270 4.4e-05
Down syndrome 1.700 1.9e-03
ductal carcinoma in situ 1.200 4.4e-02
esophageal adenocarcinoma -2.300 2.2e-02
fibroadenoma 1.300 5.8e-03
glioblastoma -1.400 2.4e-02
group 3 medulloblastoma -2.600 1.7e-03
head and neck cancer -1.500 5.5e-03
interstitial cystitis 1.200 1.7e-02
intraductal papillary-mucinous carcinoma... 2.200 1.5e-02
lung cancer -1.400 1.3e-04
malignant mesothelioma 1.600 2.3e-07
medulloblastoma, large-cell -3.100 4.0e-04
oligodendroglioma -1.600 5.1e-06
ovarian cancer -3.000 3.7e-07
pediatric high grade glioma -2.300 5.7e-04
pituitary cancer -2.100 6.7e-04
posterior fossa group A ependymoma 1.300 1.6e-05
psoriasis -1.100 3.4e-44
subependymal giant cell astrocytoma -1.500 2.0e-02
tuberculosis -1.100 6.2e-04
type II diabetes mellitus and post-ische... 1.500 1.9e-02

Gene RIF (52)

AA Sequence

MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFD      1 - 70
AKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKV     71 - 140
HSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDV    141 - 210
SILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSS    211 - 280
TQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQ    281 - 350
KLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN    351 - 420
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILN    421 - 490
VTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEK    491 - 560
LRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGAS    561 - 630
GGPTIEEVD                                                                 631 - 639
//

Text Mined References (75)

PMID Year Title