Property Summary

NCBI Gene PubMed Count 121
Grant Count 28
R01 Count 16
Funding $1,910,882.51
PubMed Score 18.57
PubTator Score 779.17

Knowledge Summary

Patent (2,708)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 0.019
ependymoma -2.200 0.009
oligodendroglioma -2.300 0.017
glioblastoma -2.100 0.000
medulloblastoma -2.100 0.003
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.200 0.005
lung cancer 1.400 0.002
interstitial cystitis -1.200 0.016
adult high grade glioma -2.000 0.000
lung carcinoma 1.200 0.000

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (92)

PMID Text
26831516 These data are in accordance with R6 binding directly to AMPKbeta2 when both proteins detach from the diminishing glycogen particle, which is simultaneous with increased AMPKbeta2 Thr-148 autophosphorylation.
26427488 Data show that activated AMP-activated protein kinase (AMPK) limits retinal pigment epithelial cells (RPE) phagocytic activity by abolishing retinal photoreceptor cell outer segment (POS)-induced activation of c-mer proto-oncogene tyrosine kinase (MerTK).
26374855 AMPK-alpha-2 binds to ER-alpha, as well as ER-beta.
26351140 A subunit composition of AMPK (alpha2beta2gamma1) is preferred for colorectal cancer cell survival, at least in part, by stabilizing the tumor-specific expression of PGC1B.
26337566 p-AMPKalpha was associated with cervical carcinogenesis, and high expression of AMPKalpha2 was correlated with better disease-free survival in patients with early-stage cervical cancer
26108355 AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury.
25858560 Data (including data from studies in knockout mice) suggest AMPK activation (AMPKa1 or AMPKa2) suppresses inflammation in vascular smooth muscle cells by down-regulation of STAT1 signaling and up-regulation of MKP-1 (dual specificity phosphatase 1).
25846811 The basal level of ERK phosphorylation was suppressed in cells treated with siRNA against PRKAA2 (AMPK-knockdown cells).
25840010 These data define the master metabolic regulator AMPK as a novel stress granule constituent that also controls their biogenesis.
25799226 AMPKalpha2 is an essential mediator of nicotine-induced whole-body IR in spite of reductions in adiposity
More...

AA Sequence

MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKL      1 - 70
FRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDL     71 - 140
KPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCG    141 - 210
TLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED    211 - 280
PSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGS    281 - 350
FMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY    351 - 420
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSC    421 - 490
SAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR            491 - 552
//

Text Mined References (145)

PMID Year Title
26831516 2016 The interaction between AMPK?2 and the PP1-targeting subunit R6 is dynamically regulated by intracellular glycogen content.
26427488 2016 Blockade of MerTK Activation by AMPK Inhibits RPE Cell Phagocytosis.
26374855 2015 Oestrogen receptors interact with the ?-catalytic subunit of AMP-activated protein kinase.
26351140 2015 AMPK Promotes Aberrant PGC1? Expression To Support Human Colon Tumor Cell Survival.
26337566 2015 Prognostic Significance of AMP-Dependent Kinase Alpha Expression in Cervical Cancer.
26108355 2015 AMPK?2 reduces renal epithelial transdifferentiation and inflammation after injury through interaction with CK2?.
25858560 2015 AMPK Suppresses Vascular Inflammation In Vivo by Inhibiting Signal Transducer and Activator of Transcription-1.
25846811 2015 Negative regulation of the LKB1/AMPK pathway by ERK in human acute myeloid leukemia cells.
25840010 2015 5'-AMP-activated protein kinase alpha regulates stress granule biogenesis.
25799226 2015 Activation of AMPK?2 in adipocytes is essential for nicotine-induced insulin resistance in vivo.
More...