Property Summary

Ligand Count 2
NCBI Gene PubMed Count 133
PubMed Score 21.13
PubTator Score 779.17

Knowledge Summary

Patent (2,708)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.000 2.3e-04
astrocytic glioma -1.900 1.9e-02
atypical teratoid / rhabdoid tumor -1.500 2.4e-03
ependymoma -1.300 1.3e-02
glioblastoma -1.100 2.5e-03
group 4 medulloblastoma -1.400 1.1e-02
interstitial cystitis -1.200 1.6e-02
lung cancer 1.400 2.1e-03
lung carcinoma 1.200 4.4e-12
medulloblastoma, large-cell -1.200 4.9e-03
oligodendroglioma -1.300 3.4e-02

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (104)

AA Sequence

MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKL      1 - 70
FRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDL     71 - 140
KPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCG    141 - 210
TLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED    211 - 280
PSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGS    281 - 350
FMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY    351 - 420
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSC    421 - 490
SAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR            491 - 552
//

Text Mined References (157)

PMID Year Title