Property Summary

NCBI Gene PubMed Count 59
PubMed Score 8.69
PubTator Score 5.54

Knowledge Summary

Patent (833)

Expression

Synonym

Accession P54619 B4DDT7 Q8N7V9 AMPK gamma1
Symbols AMPKG

Gene

PANTHER Protein Class (2)

PDB

2UV4   2UV5   2UV6   2UV7   4CFE   4CFF   4RER   4REW   4ZHX   5EZV  

 Collection (1)

Gene RIF (37)

PMID Text
26351140 A subunit composition of AMPK (alpha2beta2gamma1) is preferred for colorectal cancer cell survival, at least in part, by stabilizing the tumor-specific expression of PGC1B.
26276391 Pin1 plays an important role in the pathogenic mechanisms underlying impaired glucose and lipid metabolism, functioning as a negative regulator of AMPK
25267969 Letter: report PRKAG1 frameshift mutations in colorectal cancer.
24356547 Electrogenic phosphate transport in sodium/phosphate cotransporter NaPi-IIa-expressing Xenopus oocytes is markedly decreased by the coexpression of constitutively active AMPKgammaR70Q, but not of AMPK(alphaK45R).
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
23479427 PRKAG1 interacts with DSCAM through its gamma subunit, and netrin-1 activates AMPK phosphorylation in cortical neurons.
22935535 Studies suggest insights into the regulation of AMPK, its diverse biological actions, and therapeutic potential in the heart.
22897928 Data indicate that except AMPK-alpha1, expressions of the other five AMPK subunits -alpha2, -beta1, -beta2, -gamma1 and -gamma2 are significantly higher in ovarian carcinomas.
22456184 Conclude that cTnI phosphorylation by AMPK may represent a novel mechanism of regulation of cardiac function.
22363791 In breast cancer cells SESN2 is associated with AMPK.
More...

AA Sequence

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVR      1 - 70
AAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFD     71 - 140
AVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTT    141 - 210
TPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCY    211 - 280
LHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP                       281 - 331
//

Publication (69)

PMID Year Title
26351140 2015 AMPK Promotes Aberrant PGC1? Expression To Support Human Colon Tumor Cell Survival.
26276391 2015 Prolyl isomerase Pin1 negatively regulates AMP-activated protein kinase (AMPK) by associating with the CBS domain in the ? subunit.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25267969 2014 Frameshift mutations of PRKAG1 gene encoding an AMPK gamma subunit in colorectal cancers.
24356547 2013 Down-regulation of the Na+-coupled phosphate transporter NaPi-IIa by AMP-activated protein kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23479427 2013 AMPK interacts with DSCAM and plays an important role in netrin-1 induced neurite outgrowth.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...