Property Summary

NCBI Gene PubMed Count 61
PubMed Score 9.02
PubTator Score 5.54

Knowledge Summary

Patent (833)

Expression

Protein-protein Interaction (9)

Gene RIF (38)

AA Sequence

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVR      1 - 70
AAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFD     71 - 140
AVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTT    141 - 210
TPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCY    211 - 280
LHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP                       281 - 331
//

Text Mined References (75)

PMID Year Title