Property Summary

NCBI Gene PubMed Count 40
Grant Count 33
R01 Count 20
Funding $4,170,649.45
PubMed Score 264.55
PubTator Score 49.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.049
primary pancreatic ductal adenocarcinoma -1.054 0.004
colon cancer 1.100 0.000
diabetes mellitus -1.300 0.004
ovarian cancer 2.000 0.000
pancreatic cancer -1.400 0.001
dermatomyositis 1.100 0.008

Gene RIF (24)

PMID Text
27025069 Computational modeling of molecular dynamics of G41R mutant form of human tyrosyl-tRNA synthetase, assosiated with Charcot-Marie-Tooth neuropathy has been presented.
26773056 Data show that the internal deletion of tyrosyl-tRNA synthetase TyrRSDeltaE2-4 splice variants (SVs) gave an alternative, neomorphic dimer interface 'orthogonal' to that of native TyrRS.
26138142 Expression of CMT-mutant tyrosyl-tRNA synthetase in Drosophila impairs protein translation.
25284223 nuclear-localized TyrRS activates transcription factor E2F1 to upregulate the expression of DNA damage repair genes such as BRCA1 and RAD51.
24907514 rhTyrRS promotes migration and aggregation of megakaryocytes to the bone marrow niche
24807208 This study presents genetic evidence for common mutant-specific interactions between two CMT-associated aminoacyl-tRNA synthetases, lending support for a shared mechanism responsible for the synthetase-induced peripheral neuropathies.
24611875 A major difference between the first- and second-generation tRNA synthetases (RSs) is that the second-generation RSs have an active site more compatible with tyrosine binding.
24354524 the association of rare YARS variant with late-onset autosomal dominant Charcot-Marie-Tooth neuropathy
23334919 The full length tyrosyl-tRNA synthetase lacks its cytokine activity because of the interactions between N-terminal and the C-terminal modules, which protect the ELR cytokine motif.
22291016 Nuclear import of TyrRS is regulated by tRNA(Tyr).
More...

AA Sequence

MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT      1 - 70
ILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVV     71 - 140
TQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHL    141 - 210
MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD    211 - 280
EKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPM    281 - 350
AKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV    351 - 420
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEK    421 - 490
LQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS                                    491 - 528
//

Text Mined References (46)

PMID Year Title
27025069 [COMPUTATIONAL MODELING OF MOLECULAR DYNAMICS OF G41R MUTANT FORM OF HUMAN TYROSYL-tRNA SYNTHETASE, ASSOSIATED WITH CHARCOT-MARIE-TOOTH NEUROPATHY].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26773056 2016 Alternative splicing creates two new architectures for human tyrosyl-tRNA synthetase.
26138142 2015 Impaired protein translation in Drosophila models for Charcot-Marie-Tooth neuropathy caused by mutant tRNA synthetases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25284223 2014 Oxidative stress diverts tRNA synthetase to nucleus for protection against DNA damage.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24907514 2014 Recombinant human tyrosyl-tRNA synthetase, a novel thrombopoietic agent.
24807208 2014 CMT-associated mutations in glycyl- and tyrosyl-tRNA synthetases exhibit similar pattern of toxicity and share common genetic modifiers in Drosophila.
24627108 2014 Whole-exome sequencing in patients with inherited neuropathies: outcome and challenges.
More...