Property Summary

NCBI Gene PubMed Count 40
PubMed Score 264.55
PubTator Score 49.23

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.049
primary pancreatic ductal adenocarcinoma -1.054 0.004
colon cancer 1.100 0.000
diabetes mellitus -1.300 0.004
ovarian cancer 2.000 0.000
pancreatic cancer -1.400 0.001
dermatomyositis 1.100 0.008


Accession P54577 B3KWK4 D3DPQ4 O43276 Q53EN1
Symbols YRS


PANTHER Protein Class (2)


1N3L   1NTG   1Q11   4Q93   4QBT  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (24)

27025069 Computational modeling of molecular dynamics of G41R mutant form of human tyrosyl-tRNA synthetase, assosiated with Charcot-Marie-Tooth neuropathy has been presented.
26773056 Data show that the internal deletion of tyrosyl-tRNA synthetase TyrRSDeltaE2-4 splice variants (SVs) gave an alternative, neomorphic dimer interface 'orthogonal' to that of native TyrRS.
26138142 Expression of CMT-mutant tyrosyl-tRNA synthetase in Drosophila impairs protein translation.
25284223 nuclear-localized TyrRS activates transcription factor E2F1 to upregulate the expression of DNA damage repair genes such as BRCA1 and RAD51.
24907514 rhTyrRS promotes migration and aggregation of megakaryocytes to the bone marrow niche
24807208 This study presents genetic evidence for common mutant-specific interactions between two CMT-associated aminoacyl-tRNA synthetases, lending support for a shared mechanism responsible for the synthetase-induced peripheral neuropathies.
24611875 A major difference between the first- and second-generation tRNA synthetases (RSs) is that the second-generation RSs have an active site more compatible with tyrosine binding.
24354524 the association of rare YARS variant with late-onset autosomal dominant Charcot-Marie-Tooth neuropathy
23334919 The full length tyrosyl-tRNA synthetase lacks its cytokine activity because of the interactions between N-terminal and the C-terminal modules, which protect the ELR cytokine motif.
22291016 Nuclear import of TyrRS is regulated by tRNA(Tyr).

AA Sequence

LQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS                                    491 - 528

Text Mined References (46)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26773056 2016 Alternative splicing creates two new architectures for human tyrosyl-tRNA synthetase.
26138142 2015 Impaired protein translation in Drosophila models for Charcot-Marie-Tooth neuropathy caused by mutant tRNA synthetases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25284223 2014 Oxidative stress diverts tRNA synthetase to nucleus for protection against DNA damage.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24907514 2014 Recombinant human tyrosyl-tRNA synthetase, a novel thrombopoietic agent.
24807208 2014 CMT-associated mutations in glycyl- and tyrosyl-tRNA synthetases exhibit similar pattern of toxicity and share common genetic modifiers in Drosophila.
24627108 2014 Whole-exome sequencing in patients with inherited neuropathies: outcome and challenges.