Property Summary

Ligand Count 17
NCBI Gene PubMed Count 43
PubMed Score 272.60
PubTator Score 49.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 4.9e-02
colon cancer 1.100 2.8e-04
dermatomyositis 1.100 7.8e-03
diabetes mellitus -1.300 3.8e-03
ovarian cancer 2.000 8.6e-06
pancreatic cancer -1.400 5.1e-04
primary pancreatic ductal adenocarcinoma -1.054 4.1e-03

Gene RIF (26)

AA Sequence

MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT      1 - 70
ILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVV     71 - 140
TQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHL    141 - 210
MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD    211 - 280
EKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPM    281 - 350
AKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV    351 - 420
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEK    421 - 490
LQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS                                    491 - 528
//

Text Mined References (49)

PMID Year Title