Property Summary

NCBI Gene PubMed Count 36
Grant Count 4
R01 Count 4
Funding $468,527.25
PubMed Score 20.14
PubTator Score 48.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.384 0.018
Multiple myeloma 2.058 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
intraductal papillary-mucinous neoplasm ... -1.400 0.002
lung cancer -3.700 0.041
diabetes mellitus -1.600 0.001
ovarian cancer 3.700 0.000

Gene RIF (22)

PMID Text
26305948 Data show the the interplay between the enzyme ornithine decarboxylase (ODC) and two regulatory proteins: antizyme (Az) and inhibitor (AzIN).
25318549 Results show that ornithine decarboxylase antizyme 1 (OAZ1) simultaneously inhibits the proliferation and induces the differentiation of oral cancer cells.
24930035 the effects of AZ on cell growth are independent of polyamines.
24192781 To further understand its functions in CML pathogenesis, OAZ1 was overexpressed, and PCR array analysis was used to monitor the expression of key genes commonly involved in leukemia development.
23260169 Gene expression studies have identified altered expression of ornithine decarboxylase antizyme 1 in suicide completers with a history of mood disorders.
22157018 In the absence of amino acids, mTORC1 is inhibited, whereas mTORC2 is activated, leading to the inhibition of global protein synthesis and increased AZ1 synthesis via a cap-independent mechanism.
22008221 This study demomistrated that H3K4me3 modification plays an important role in up regulation of AOAZ1 in prefrontal cortex.
21931692 AZ_95-176 is the minimal AZ peptide that is fully functioning in the binding of ODC and AZI and inhibition of their function.
21552531 the differences in residues 125 and 140 in ODC and AZI are responsible for the differential antizyme-binding affinities
20861309 Data show that OAZ promotes the removal of Mps1 from centrosomes, and centrosome overproduction caused by reducing OAZ activity requires Mps1.
More...

AA Sequence

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDA      1 - 70
PHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLY     71 - 140
IEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPD    141 - 210
ACFMAYTFERESSGEEEE                                                        211 - 228
//

Text Mined References (38)

PMID Year Title
26305948 2015 Structural basis of antizyme-mediated regulation of polyamine homeostasis.
25318549 2014 Effects of ornithine decarboxylase antizyme 1 on the proliferation and differentiation of human oral cancer cells.
24930035 2014 Antizyme (AZ) regulates intestinal cell growth independent of polyamines.
24192781 2014 Assay of OAZ1 mRNA levels in chronic myeloid leukemia combined with application of leukemia PCR array identified relevant gene changes affected by antizyme.
23260169 2013 Effects of promoter methylation on increased expression of polyamine biosynthetic genes in suicide.
22157018 2012 Amino acids regulate expression of antizyme-1 to modulate ornithine decarboxylase activity.
22008221 2012 Effects of histone modifications on increased expression of polyamine biosynthetic genes in suicide.
21931692 2011 Minimal antizyme peptide fully functioning in the binding and inhibition of ornithine decarboxylase and antizyme inhibitor.
21552531 2011 Critical factors governing the difference in antizyme-binding affinities between human ornithine decarboxylase and antizyme inhibitor.
20861309 2010 Antizyme restrains centrosome amplification by regulating the accumulation of Mps1 at centrosomes.
More...