Property Summary

NCBI Gene PubMed Count 36
PubMed Score 22.01
PubTator Score 48.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 8.4e-05
diabetes mellitus -1.600 1.0e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.6e-03
lung cancer -3.700 4.1e-02
Multiple myeloma 2.058 9.6e-05
ovarian cancer -1.600 4.2e-07
Waldenstrons macroglobulinemia 1.384 1.8e-02

Synonym

Accession P54368 O43382 Q14989 Q92595 Q9UPL9 AZ1
Symbols AZ1
AZI
OAZ

Gene

PANTHER Protein Class (1)

PDB

4ZGZ   4ZGY   5BWA  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (22)

AA Sequence

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDA      1 - 70
PHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLY     71 - 140
IEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPD    141 - 210
ACFMAYTFERESSGEEEE                                                        211 - 228
//

Text Mined References (39)

PMID Year Title