Property Summary

Ligand Count 153
NCBI Gene PubMed Count 52
PubMed Score 32.48
PubTator Score 18.70

Knowledge Summary

Patent (3,570)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Liver disease 237 0.0 0.9
ulcerative colitis 1819 0.0 0.00287847328844915
Disease Target Count Z-score Confidence
Malignant hyperthermia 26 4.199 2.1
Disease Target Count Z-score Confidence
Short QT syndrome 12 4.378 2.2
Mastitis 48 3.718 1.9
Timothy syndrome 11 3.149 1.6
Disease Target Count
Brugada syndrome 29
Short QT Syndrome 1 4

Expression

  Differential Expression (28)

Disease log2 FC p
ulcerative colitis 1.100 2.9e-03
adult high grade glioma -1.500 9.8e-03
astrocytoma -1.800 2.0e-13
Astrocytoma, Pilocytic -1.400 6.9e-05
Atopic dermatitis -1.400 1.5e-04
atypical teratoid / rhabdoid tumor -2.900 3.9e-03
Breast cancer -2.400 3.5e-08
breast carcinoma -1.300 4.2e-18
colon cancer -2.500 5.7e-06
dermatomyositis -1.300 2.9e-03
ductal carcinoma in situ -1.900 5.3e-03
ependymoma -2.300 7.7e-05
glioblastoma -2.000 1.0e-04
group 3 medulloblastoma 1.200 4.4e-02
invasive ductal carcinoma -3.100 1.6e-03
lung carcinoma 3.000 2.1e-30
malignant mesothelioma -2.700 1.8e-06
medulloblastoma, large-cell 2.100 7.9e-04
nasopharyngeal carcinoma 2.400 1.1e-04
oligodendroglioma -1.700 2.7e-09
osteosarcoma 1.279 7.6e-04
ovarian cancer -3.900 4.1e-08
Pick disease -1.800 2.1e-02
pituitary cancer 1.300 1.0e-02
primary pancreatic ductal adenocarcinoma 1.017 5.1e-03
primitive neuroectodermal tumor -2.500 1.3e-03
psoriasis -1.200 1.8e-24
sarcoidosis 1.100 1.2e-02

Gene RIF (18)

AA Sequence

MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTV      1 - 70
EPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEP     71 - 140
GSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGS    141 - 210
ATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEML    211 - 280
ETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVS    281 - 350
RANCNKIIMLFTDGGEERAQEIFNKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR    351 - 420
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGV    421 - 490
DVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLD    491 - 560
FLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYY    561 - 630
IKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNAD    631 - 700
LINRVLLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDN    701 - 770
DNYVFTAPYFNKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCD    771 - 840
CKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGAAP    841 - 910
KQGAGHRSAYVPSVADILQIGWWATAAAWSILQQFLLSLTFPRLLEAVEMEDDDFTASLSKQSCITEQTQ    911 - 980
YFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDGPNPCDMVKQP    981 - 1050
RYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWYIIGIQFLLLWLVSGSTHRLL                    1051 - 1103
//

Text Mined References (53)

PMID Year Title