Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.45
PubTator Score 7.19

Knowledge Summary

Patent (1,502)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 3.0e-03
astrocytoma -1.100 2.4e-24
Astrocytoma, Pilocytic -1.900 1.7e-07
atypical teratoid / rhabdoid tumor -1.500 1.4e-05
ependymoma -1.700 3.0e-12
glioblastoma -1.300 7.5e-07
intraductal papillary-mucinous carcinoma... 1.300 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 8.8e-03
invasive ductal carcinoma 1.200 1.9e-02
lung cancer -1.800 3.8e-03
malignant mesothelioma -1.200 4.6e-06
medulloblastoma -1.200 2.9e-05
medulloblastoma, large-cell -1.500 3.9e-05
oligodendroglioma -1.100 9.2e-18
ovarian cancer -1.900 1.8e-11
primitive neuroectodermal tumor -1.200 3.6e-02
subependymal giant cell astrocytoma -1.334 9.0e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSY      1 - 70
CGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGN     71 - 140
PSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDG    141 - 210
RISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQL    211 - 280
AKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLA    281 - 350
EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR    351 - 420
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY          421 - 484
//

Text Mined References (21)

PMID Year Title