Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.63
PubTator Score 7.19

Knowledge Summary

Patent (1,502)

Expression

  Differential Expression (17)

 GWAS Trait (1)

Gene RIF (1)

PMID Text
19917615 in the presence of Pax6(S), beta(3) is translocated from the cytoplasm to the nucleus;full-length Ca(v)beta may act directly as a transcription regulator independent of its role in regulating Ca(2+) channel activity

AA Sequence

MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSY      1 - 70
CGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGN     71 - 140
PSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDG    141 - 210
RISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQL    211 - 280
AKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLA    281 - 350
EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR    351 - 420
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY          421 - 484
//

Text Mined References (20)

PMID Year Title
25527503 2015 Functional characterization of CaV?2? mutations associated with sudden cardiac death.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
19917615 2010 The beta subunit of voltage-gated Ca2+ channels interacts with and regulates the activity of a novel isoform of Pax6.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
16541075 2006 The finished DNA sequence of human chromosome 12.
16525042 2006 Alternative splicing of the voltage-gated Ca2+ channel beta4 subunit creates a uniquely folded N-terminal protein binding domain with cell-specific expression in the cerebellar cortex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15170217 2004 Structural basis of the alpha1-beta subunit interaction of voltage-gated Ca2+ channels.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
More...