Property Summary

NCBI Gene PubMed Count 146
Grant Count 148
R01 Count 112
Funding $14,190,782.99
PubMed Score 394.20
PubTator Score 338.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Crohn's disease -1.138 0.014
ulcerative colitis -1.360 0.020
ovarian cancer -1.300 0.000

Synonym

Accession P54274 A7XP29 Q15553 Q8NHT6 Q93029
Symbols TRF
PIN2
TRF1
TRBF1
t-TRF1
hTRF1-AS

Gene

PANTHER Protein Class (1)

PDB

3L82   3BQO   1BA5   1H6O   1ITY   1IV6   1W0T   5HKP  

Gene RIF (87)

PMID Text
26658719 Data indicate that overexpression of telomeric repeat binding factor 1 (TRF1) in aging endothelial cells (EC) reduced telomere-associated DNA damage foci.
26403970 ZSCAN4 indirectly interacts with TRF1 in cancer cells. We show that ZSCAN4 plays an important role independent of telomere maintenance pathways (telomerase positive and alternative pathway) or cell lineage.
26240333 analysis of human telomere repeat binding factor 1 (hTRF1) in complex with Escherichia coli Hsp70 (DnaK)
25892537 Results showed significant interaction between variants at TERF1 and AFAP1L2 loci. Given the key role of TERF1 in telomere biology and its physical interaction with AFAP1L2, these results support a role for telomere dysfunction in melanoma development.
25819337 we provide mechanistic insight into the role of TRF1 in liver regeneration and provide a mouse model recapitulating the clinical features of LLCC.
24876105 Modulating miR-155 expression in cells altered TRF1 levels and TRF1 abundance at telomeres. Compromising TRF1 expression by elevating miR-155 increased telomere fragility and altered the structure of metaphase chromosomes.
24752893 this study demonstrates an essential role of TRF1 in the centromeric localization of Aurora-B kinase, which is required for correction of the merotelic attachment of microtubules to a single kinetochore and for proper chromosome segregation.
24692559 TAP68 functions in mediating TRF1-tankyrase 1 localization to the centrosome and in mitotic regulation
24626180 TRF1 links TopoIIalpha and SAC proteins in a pathway that ensures correct telomere replication and mitotic segregation, unveiling how TRF1 protects from telomere fragility and mitotic defects.
24415760 these findings suggested that PinX1 may maintain telomere integrity by regulating TRF1 stability and that hTERT may act as both a positive and a negative regulator of TRF1 homeostasis in a PinX1-dependent manner.
More...

AA Sequence

MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA      1 - 70
EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA     71 - 140
QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF    141 - 210
KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG    211 - 280
NDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK    281 - 350
KKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML    351 - 420
KDRWRTMKKLKLISSDSED                                                       421 - 439
//

Text Mined References (152)

PMID Year Title
26658719 2016 Age intrinsic loss of telomere protection via TRF1 reduction in endothelial cells.
26586433 2015 ATM and ATR Signaling Regulate the Recruitment of Human Telomerase to Telomeres.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26403970 2015 ZSCAN4 and TRF1: A functionally indirect interaction in cancer cells independent of telomerase activity.
26240333 2015 Mapping the conformation of a client protein through the Hsp70 functional cycle.
25892537 2015 Integrated pathway and epistasis analysis reveals interactive effect of genetic variants at TERF1 and AFAP1L2 loci on melanoma risk.
25819337 2015 Chronic replicative stress induced by CCl4 in TRF1 knockout mice recapitulates the origin of large liver cell changes.
25620558 2015 TRF2 recruits RTEL1 to telomeres in S phase to promote t-loop unwinding.
25589350 2015 Single-strand DNA-binding protein SSB1 facilitates TERT recruitment to telomeres and maintains telomere G-overhangs.
25416956 2014 A proteome-scale map of the human interactome network.
More...