Property Summary

NCBI Gene PubMed Count 37
Grant Count 144
R01 Count 86
Funding $14,824,874.14
PubMed Score 81.04
PubTator Score 115.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.009 0.000
ovarian cancer -1.100 0.000

Synonym

Accession P54257 A8MQB5 O75358 Q59GK4 Q9H4G3 Q9HA98 Q9NY90 HAP-1
Symbols HLP
HAP2
HIP5
hHLP1

Gene

PANTHER Protein Class (1)

Gene RIF (19)

PMID Text
25653285 data fully support that HAP1 is a GKAP, anchoring specifically to the cGMP-dependent protein kinase isoform Ibeta, and provide further evidence that also PKG spatiotemporal signaling is largely controlled by anchoring proteins
25446120 HAP1 gene expression is related to the radiosensitivity of breast cancer cells and may play an important role in the regulation of cellular radiosensitivity
25081373 The -141 T > G polymorphism, but not the 1349 T > G polymorphism, may have protective effects for lung cancer.
23440330 Overexpression of HAP1 reduced in vitro cell growth in breast cancer cell lines.
22731248 The results of this study suggested that HAP1 co-localizes and associates with APP in physiological conditions of mouse and human brain.
22698993 The results of this study found no association was found between the HAP1 T441M polymorphism and the age at onset of Huntington's disease .
22404213 Knockdown of huntingtin-associated protein 1 (HAP1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
21985783 WT HTT regulates ciliogenesis by interacting through huntingtin-associated protein 1 (HAP1) with pericentriolar material 1 protein (PCM1).
21386698 HAP1/stigmoid body interacts with the normal ataxin-3 through Josephin domain
21357693 sortilin stabilizes the proBDNF.HAP1 complex
More...

AA Sequence

MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQFLSEARTGARP      1 - 70
ASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGRGTGKAAGIWKTPAAYVGRRP     71 - 140
GVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYLLEELLPPVWESVTYGMVLQRERDLNTAARI    141 - 210
GQSLVKQNSVLMEENSKLEALLGSAKEEILYLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQE    211 - 280
EEEAEEDLQCAHPCDAPKLISQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLIL    281 - 350
ECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQM    351 - 420
QLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETLPGFQETLAEE    421 - 490
LRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGLMLAADIMRGEDFTPAEEF    491 - 560
VPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQ    561 - 630
LANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR                                 631 - 671
//

Text Mined References (38)

PMID Year Title
25653285 2015 Huntingtin-associated protein 1 (HAP1) is a cGMP-dependent kinase anchoring protein (GKAP) specific for the cGMP-dependent protein kinase I? isoform.
25446120 2015 HAP1 gene expression is associated with radiosensitivity in breast cancer cells.
25081373 2014 Evaluating the association of polymorphisms in the HAP1 gene with lung cancer risk: a meta-analysis.
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
23532844 2013 The Joubert syndrome-associated missense mutation (V443D) in the Abelson-helper integration site 1 (AHI1) protein alters its localization and protein-protein interactions.
23440330 2013 Huntingtin-associated protein 1: a potential biomarker of breast cancer.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22731248 2012 Huntingtin associated protein 1 regulates trafficking of the amyloid precursor protein and modulates amyloid beta levels in neurons.
22698993 2012 Age at onset in Huntington's disease: replication study on the association of HAP1.
21985783 2011 Ciliogenesis is regulated by a huntingtin-HAP1-PCM1 pathway and is altered in Huntington disease.
More...