Property Summary

NCBI Gene PubMed Count 118
PubMed Score 203.42
PubTator Score 413.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Cerebellar Ataxia 304 4.163 2.1
Disease Target Count
Spinocerebellar ataxia 1 1

Expression

  Differential Expression (22)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.321 5.2e-09
adult high grade glioma -1.300 3.0e-03
astrocytic glioma 1.100 1.9e-02
atypical teratoid / rhabdoid tumor -2.700 3.4e-07
Chronic Lymphocytic Leukemia 3.524 1.6e-10
cystic fibrosis -1.354 1.9e-05
dermatomyositis 1.100 2.0e-03
ependymoma 1.100 1.8e-02
glioblastoma -1.100 7.6e-05
group 3 medulloblastoma -2.100 3.2e-03
hepatocellular carcinoma -1.100 9.0e-03
intraductal papillary-mucinous adenoma (... 1.600 4.0e-05
intraductal papillary-mucinous carcinoma... 1.600 2.7e-04
lung cancer -1.400 5.5e-03
malignant mesothelioma -2.300 3.3e-08
medulloblastoma, large-cell -4.900 5.7e-07
osteosarcoma 1.621 1.4e-06
ovarian cancer -1.100 5.3e-08
primitive neuroectodermal tumor -1.900 3.2e-05
Rheumatoid arthritis 2.000 7.3e-04
subependymal giant cell astrocytoma -1.635 2.5e-02
tuberculosis -1.600 2.0e-04

Protein-protein Interaction (1)

Gene RIF (84)

AA Sequence

MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRHGPAGTSVELG      1 - 70
LQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQYAHLPHTFQFIGSSQYSGTYA     71 - 140
SFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTLLANMGSLSQTPGHKAEQQQQQQQQQQQQHQ    141 - 210
HQQQQQQQQQQQQQQHLSRAPGLITPGSPPPAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHT    211 - 280
LTLGPPSQVVMQYADSGSHFVPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGK    281 - 350
SVPHPYESRHVVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLGK    351 - 420
PGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLPQHLVIPGTQPL    421 - 490
LIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVTQAAYPAMVQAQIHLPVVQSV    491 - 560
ASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQ    561 - 630
FAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQP    631 - 700
VDPASVLLKHSKADGLAGSRHRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATR    701 - 770
KRRWSAPESRKLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK                             771 - 815
//

Text Mined References (121)

PMID Year Title