Property Summary

NCBI Gene PubMed Count 196
PubMed Score 773.71
PubTator Score 892.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Machado-Joseph disease 18 8.933 4.0
Nerve Degeneration 121 0.0 0.0
Disease Target Count P-value
psoriasis 6694 9.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 0.9
Disease Target Count
PARKINSON DISEASE, LATE-ONSET 20

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 9.8e-03

Protein-protein Interaction (1)

Gene RIF (163)

AA Sequence

MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD      1 - 70
DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP     71 - 140
ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE    141 - 210
RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE    211 - 280
LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET    281 - 350
VRNDLKTEGKK                                                               351 - 361
//

Text Mined References (200)

PMID Year Title